#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /usr/lib64/python2.7/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /usr/lib64/python2.7/calendar.pyc
�
ٜSec@s�dZddlZddlZddlZddddddd	d
ddd
dddddddgZeZdefd��YZdefd��YZ	dZ
dZdddddddddddddg
Zdd?d��YZ
dd@d ��YZed!�Zed"�Ze
d#�Ze
d$�Zed%�\ZZZZZZZd&�Zd'�Zd(�Zd)�Zd*efd+��YZ d,e fd-��YZ!d.e fd/��YZ"d0dAd1��YZ#d2e!fd3��YZ$d4e"fd5��YZ%e!�Z&e&j'Z(d6�Z)e&j*Z+e&j,Z,e&j-Z.e&j/Z0e&j1Z1e&j2Z3e&j4Z5e&j6Z7dCZ8d8Z9e8e9d9�Z:e8e9d:�Z;d;Z<ej=e<dd�j>�Z?d<�Z@d=�ZAeBd>kr�eAejC�ndS(Ds$Calendar printing functions

Note when comparing these calendars to the ones printed by cal(1): By
default, these calendars have Monday as the first day of the week, and
Sunday as the last (the European convention). Use setfirstweekday() to
set the first day of the week (0=Monday, 6=Sunday).i����NtIllegalMonthErrortIllegalWeekdayErrortsetfirstweekdaytfirstweekdaytisleaptleapdaystweekdayt
monthranget
monthcalendartprmonthtmonthtprcaltcalendarttimegmt
month_namet
month_abbrtday_nametday_abbrcBseZd�Zd�ZRS(cCs
||_dS(N(R
(tselfR
((s /usr/lib64/python2.7/calendar.pyt__init__scCsd|jS(Ns!bad month number %r; must be 1-12(R
(R((s /usr/lib64/python2.7/calendar.pyt__str__s(t__name__t
__module__RR(((s /usr/lib64/python2.7/calendar.pyRs	cBseZd�Zd�ZRS(cCs
||_dS(N(R(RR((s /usr/lib64/python2.7/calendar.pyRscCsd|jS(Ns7bad weekday number %r; must be 0 (Monday) to 6 (Sunday)(R(R((s /usr/lib64/python2.7/calendar.pyRs(RRRR(((s /usr/lib64/python2.7/calendar.pyRs	iiiiiit_localized_monthcBskeZged�D]"Zejdedd�j^qZejdd��d�Z	d�Z
d�ZRS(ii�iicCsdS(Nt((tx((s /usr/lib64/python2.7/calendar.pyt<lambda>2scCs
||_dS(N(tformat(RR((s /usr/lib64/python2.7/calendar.pyR4scCsM|j|}t|t�r<g|D]}||j�^q#S||j�SdS(N(t_monthst
isinstancetsliceR(Rtitfuncstf((s /usr/lib64/python2.7/calendar.pyt__getitem__7s
 cCsdS(Ni
((R((s /usr/lib64/python2.7/calendar.pyt__len__>s(RRtrangeRtdatetimetdatetstrftimeRtinsertRR"R#(((s /usr/lib64/python2.7/calendar.pyR/s
5		t_localized_daycBsXeZged�D]"Zejdded�j^qZd�Zd�Z	d�Z
RS(ii�icCs
||_dS(N(R(RR((s /usr/lib64/python2.7/calendar.pyRGscCsM|j|}t|t�r<g|D]}||j�^q#S||j�SdS(N(t_daysRRR(RRR R!((s /usr/lib64/python2.7/calendar.pyR"Js
 cCsdS(Ni((R((s /usr/lib64/python2.7/calendar.pyR#Qs(RRR$RR%R&R'R*RR"R#(((s /usr/lib64/python2.7/calendar.pyR)Bs5		s%As%as%Bs%bicCs.|ddko-|ddkp-|ddkS(s5Return True for leap years, False for non-leap years.iiidi�((tyear((s /usr/lib64/python2.7/calendar.pyRascCsD|d8}|d8}|d|d|d|d|d|dS(sFReturn number of leap years in range [y1, y2).
       Assume y1 <= y2.iiidi�((ty1ty2((s /usr/lib64/python2.7/calendar.pyRfs

cCstj|||�j�S(sTReturn weekday (0-6 ~ Mon-Sun) for year (1970-...), month (1-12),
       day (1-31).(R%R&R(R+R
tday((s /usr/lib64/python2.7/calendar.pyRnscCsgd|kodkns+t|��nt||d�}t||tkoYt|�}||fS(sQReturn weekday (0-6 ~ Mon-Sun) and number of days (28-31) for
       year, month.ii(RRtmdaystFebruaryR(R+R
tday1tndays((s /usr/lib64/python2.7/calendar.pyRts
 tCalendarcBs�eZdZdd�Zd�Zd�Zeee�Zd�Zd�Z	d�Z
d�Zd	�Zd
�Z
d�Zdd
�Zdd�Zdd�ZRS(so
    Base calendar class. This class doesn't do any formatting. It simply
    provides data to subclasses.
    icCs
||_dS(N(R(RR((s /usr/lib64/python2.7/calendar.pyR�scCs|jdS(Ni(t
_firstweekday(R((s /usr/lib64/python2.7/calendar.pytgetfirstweekday�scCs
||_dS(N(R4(RR((s /usr/lib64/python2.7/calendar.pyR�sccs1x*t|j|jd�D]}|dVqWdS(ss
        Return a iterator for one week of weekday numbers starting with the
        configured first one.
        iN(R$R(RR((s /usr/lib64/python2.7/calendar.pytiterweekdays�s ccs�tj||d�}|j�|jd}|tjd|�8}tjdd�}xZtr�|Vy||7}Wntk
r�PnX|j|krW|j�|jkrWPqWqWWdS(s�
        Return an iterator for one month. The iterator will yield datetime.date
        values and will always iterate through complete weeks, so it will yield
        dates outside the specified month.
        iitdaysN(R%R&RRt	timedeltatTruet
OverflowErrorR
(RR+R
R&R7toneday((s /usr/lib64/python2.7/calendar.pytitermonthdates�s	
$ccsXxQ|j||�D]=}|j|kr<d|j�fVq|j|j�fVqWdS(s�
        Like itermonthdates(), but will yield (day number, weekday number)
        tuples. For days outside the specified month the day number is 0.
        iN(R<R
RR.(RR+R
R&((s /usr/lib64/python2.7/calendar.pytitermonthdays2�sccs@x9|j||�D]%}|j|kr0dVq|jVqWdS(s�
        Like itermonthdates(), but will yield day numbers. For days outside
        the specified month the day number is 0.
        iN(R<R
R.(RR+R
R&((s /usr/lib64/python2.7/calendar.pyt
itermonthdays�scCsLt|j||��}gtdt|�d�D]}|||d!^q1S(s�
        Return a matrix (list of lists) representing a month's calendar.
        Each row represents a week; week entries are datetime.date values.
        ii(tlistR<R$tlen(RR+R
tdatesR((s /usr/lib64/python2.7/calendar.pytmonthdatescalendar�scCsLt|j||��}gtdt|�d�D]}|||d!^q1S(s�
        Return a matrix representing a month's calendar.
        Each row represents a week; week entries are
        (day number, weekday number) tuples. Day numbers outside this month
        are zero.
        ii(R?R=R$R@(RR+R
R7R((s /usr/lib64/python2.7/calendar.pytmonthdays2calendar�scCsLt|j||��}gtdt|�d�D]}|||d!^q1S(s�
        Return a matrix representing a month's calendar.
        Each row represents a week; days outside this month are zero.
        ii(R?R>R$R@(RR+R
R7R((s /usr/lib64/python2.7/calendar.pytmonthdayscalendar�sicCsfgtttd�D]}|j||�^q}gtdt|�|�D]}||||!^qKS(s&
        Return the data for the specified year ready for formatting. The return
        value is a list of month rows. Each month row contains upto width months.
        Each month contains between 4 and 6 weeks and each week contains 1-7
        days. Days are datetime.date objects.
        ii(R$tJanuaryRBR@(RR+twidthRtmonths((s /usr/lib64/python2.7/calendar.pytyeardatescalendar�s/cCsfgtttd�D]}|j||�^q}gtdt|�|�D]}||||!^qKS(s�
        Return the data for the specified year ready for formatting (similar to
        yeardatescalendar()). Entries in the week lists are
        (day number, weekday number) tuples. Day numbers outside this month are
        zero.
        ii(R$RERCR@(RR+RFRRG((s /usr/lib64/python2.7/calendar.pytyeardays2calendar�s/cCsfgtttd�D]}|j||�^q}gtdt|�|�D]}||||!^qKS(s�
        Return the data for the specified year ready for formatting (similar to
        yeardatescalendar()). Entries in the week lists are day numbers.
        Day numbers outside this month are zero.
        ii(R$RERDR@(RR+RFRRG((s /usr/lib64/python2.7/calendar.pytyeardayscalendar�s/(RRt__doc__RR5RtpropertyRR6R<R=R>RBRCRDRHRIRJ(((s /usr/lib64/python2.7/calendar.pyR3~s								
	

tTextCalendarcBs�eZdZd�Zd�Zd�Zd�Zd�Zed�Z	ddd�Z
ddd	�Zd
ddd
d�Zdddd
d�Z
RS(sr
    Subclass of Calendar that outputs a calendar as a simple plain text
    similar to the UNIX program cal.
    cCs|j||�GdS(s3
        Print a single week (no newline).
        N(t
formatweek(RttheweekRF((s /usr/lib64/python2.7/calendar.pytprweek	scCs,|dkrd}n
d|}|j|�S(s*
        Returns a formatted day.
        iRs%2i(tcenter(RR.RRFts((s /usr/lib64/python2.7/calendar.pyt	formatdays	
cs dj��fd�|D��S(sA
        Returns a single week in a string (no newline).
        t c3s*|] \}}�j||��VqdS(N(RS(t.0tdtwd(RRF(s /usr/lib64/python2.7/calendar.pys	<genexpr>s(tjoin(RRORF((RRFs /usr/lib64/python2.7/calendar.pyRNscCs0|dkrt}nt}||| j|�S(s4
        Returns a formatted week day name.
        i	(RRRQ(RR.RFtnames((s /usr/lib64/python2.7/calendar.pyt
formatweekdays	cs&dj��fd��j�D��S(s-
        Return a header for a week.
        RTc3s!|]}�j|��VqdS(N(RZ(RUR(RRF(s /usr/lib64/python2.7/calendar.pys	<genexpr>-s(RXR6(RRF((RRFs /usr/lib64/python2.7/calendar.pytformatweekheader)scCs0t|}|r#d||f}n|j|�S(s0
        Return a formatted month name.
        s%s %r(RRQ(RttheyeartthemonthRFtwithyearRR((s /usr/lib64/python2.7/calendar.pytformatmonthname/s
icCs|j||||�GdS(s+
        Print a month's calendar.
        N(tformatmonth(RR\R]twtl((s /usr/lib64/python2.7/calendar.pyR	8scCs�td|�}td|�}|j||d|dd�}|j�}|d|7}||j|�j�7}|d|7}xD|j||�D]0}||j||�j�7}|d|7}q�W|S(s@
        Return a month's calendar string (multi-line).
        iiis
(tmaxR_trstripR[RCRN(RR\R]RaRbRRtweek((s /usr/lib64/python2.7/calendar.pyR`>s!iiiics=td|�}td|�}td|�}|ddd�g}|j}|t��j�|||d�j��|d|��j|��x�t�j�|��D]y\}}	t||dt	||ddd��}
|d|����fd�|
D�}|t
|�|�j��|d|��fd�|
D�}|t
|�|�j��|d|�td�|	D��}
x�t|
�D]�}g}xM|	D]E}|t|�kr�|jd	�q�|j�j|||��q�W|t
|�|�j��|d|�q�Wq�Wd	j
|�S(
sC
        Returns a year's calendar as a multi-line string.
        iiis
i
c3s'|]}�j�|�t�VqdS(N(R_tFalse(RUtk(tcolwidthRR\(s /usr/lib64/python2.7/calendar.pys	<genexpr>_sc3s|]}�VqdS(N((RURg(theader(s /usr/lib64/python2.7/calendar.pys	<genexpr>cscss|]}t|�VqdS(N(R@(RUtcal((s /usr/lib64/python2.7/calendar.pys	<genexpr>gsR(RctappendtreprRQRdR[t	enumerateRIR$tmintformatstringR@RNRX(RR\RaRbtctmtvtaRtrowRGRYtheaderstheighttjtweeksRj((RhRiRR\s /usr/lib64/python2.7/calendar.pyt
formatyearNs:	/%,

!cCs|j|||||�GHdS(sPrint a year's calendar.N(Ry(RR\RaRbRpRq((s /usr/lib64/python2.7/calendar.pytpryearss(RRRKRPRSRNRZR[R9R_R	R`RyRz(((s /usr/lib64/python2.7/calendar.pyRMs		
		
		%tHTMLCalendarcBs�eZdZdddddddgZd�Zd	�Zd
�Zd�Zed�Z	ed
�Z
dd�Zdddd�Z
RS(s4
    This calendar returns complete HTML pages.
    tmonttuetwedtthutfritsattsuncCs)|dkrdSd|j||fSdS(s/
        Return a day as a table cell.
        is<td class="noday">&nbsp;</td>s<td class="%s">%d</td>N(t
cssclasses(RR.R((s /usr/lib64/python2.7/calendar.pyRS�scs'dj�fd�|D��}d|S(s8
        Return a complete week as a table row.
        Rc3s'|]\}}�j||�VqdS(N(RS(RURVRW(R(s /usr/lib64/python2.7/calendar.pys	<genexpr>�ss<tr>%s</tr>(RX(RRORR((Rs /usr/lib64/python2.7/calendar.pyRN�scCsd|j|t|fS(s:
        Return a weekday name as a table header.
        s<th class="%s">%s</th>(R�R(RR.((s /usr/lib64/python2.7/calendar.pyRZ�scs-dj�fd��j�D��}d|S(s<
        Return a header for a week as a table row.
        Rc3s|]}�j|�VqdS(N(RZ(RUR(R(s /usr/lib64/python2.7/calendar.pys	<genexpr>�ss<tr>%s</tr>(RXR6(RRR((Rs /usr/lib64/python2.7/calendar.pyR[�s%cCs3|rdt||f}ndt|}d|S(s5
        Return a month name as a table row.
        s%s %ss%ss.<tr><th colspan="7" class="month">%s</th></tr>(R(RR\R]R^RR((s /usr/lib64/python2.7/calendar.pyR_�scCs�g}|j}|d�|d�||j||d|��|d�||j��|d�x7|j||�D]#}||j|��|d�qvW|d�|d�dj|�S(s6
        Return a formatted month as a table.
        s@<table border="0" cellpadding="0" cellspacing="0" class="month">s
R^s</table>R(RkR_R[RCRNRX(RR\R]R^RrRsRe((s /usr/lib64/python2.7/calendar.pyR`�s	





icCs�g}|j}t|d�}|d�|d�|d||f�x�tttd|�D]w}t|t||d��}|d�x>|D]6}|d�||j||d	t��|d
�q�W|d�q]W|d�d
j|�S(s?
        Return a formatted year as a table of tables.
        is?<table border="0" cellpadding="0" cellspacing="0" class="year">s
s.<tr><th colspan="%d" class="year">%s</th></tr>ii
s<tr>s<td>R^s</td>s</tr>s</table>R(RkRcR$RERnR`RfRX(RR\RFRrRsRRGRq((s /usr/lib64/python2.7/calendar.pyRy�s 	





scalendar.csscCs�|dkrtj�}ng}|j}|d|�|d�|d�|d�|d|�|dk	r�|d|�n|d|�|d�|d	�||j||��|d
�|d�dj|�j|d
�S(sB
        Return a formatted year as a complete HTML page.
        s$<?xml version="1.0" encoding="%s"?>
sn<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Strict//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-strict.dtd">
s<html>
s<head>
sC<meta http-equiv="Content-Type" content="text/html; charset=%s" />
s4<link rel="stylesheet" type="text/css" href="%s" />
s<title>Calendar for %d</title>
s</head>
s<body>
s</body>
s</html>
RtxmlcharrefreplaceN(tNonetsystgetdefaultencodingRkRyRXtencode(RR\RFtcsstencodingRrRs((s /usr/lib64/python2.7/calendar.pytformatyearpage�s$	






N(RRRKR�RSRNRZR[R9R_R`RyR�R�(((s /usr/lib64/python2.7/calendar.pyR{xs					
tTimeEncodingcBs#eZd�Zd�Zd�ZRS(cCs
||_dS(N(tlocale(RR�((s /usr/lib64/python2.7/calendar.pyR�scCs?tjtj�|_tjtj|j�tjtj�dS(Ni(t_localet	getlocaletLC_TIMEt	oldlocalet	setlocaleR�(R((s /usr/lib64/python2.7/calendar.pyt	__enter__�scGstjtj|j�dS(N(R�R�R�R�(Rtargs((s /usr/lib64/python2.7/calendar.pyt__exit__�s(RRRR�R�(((s /usr/lib64/python2.7/calendar.pyR��s		tLocaleTextCalendarcBs2eZdZddd�Zd�Zed�ZRS(s
    This class can be passed a locale name in the constructor and will return
    month and weekday names in the specified locale. If this locale includes
    an encoding all strings containing month and weekday names will be returned
    as unicode.
    icCs8tj||�|dkr+tj�}n||_dS(N(RMRR�R�tgetdefaultlocaleR�(RRR�((s /usr/lib64/python2.7/calendar.pyR�scCspt|j��[}|dkr't}nt}||}|dk	rU|j|�}n|| j|�SWdQXdS(Ni	(R�R�RRR�tdecodeRQ(RR.RFR�RYtname((s /usr/lib64/python2.7/calendar.pyRZs	
cCsjt|j��U}t|}|dk	r:|j|�}n|rSd||f}n|j|�SWdQXdS(Ns%s %r(R�R�RR�R�RQ(RR\R]RFR^R�RR((s /usr/lib64/python2.7/calendar.pyR_s
N(RRRKR�RRZR9R_(((s /usr/lib64/python2.7/calendar.pyR��s	tLocaleHTMLCalendarcBs2eZdZddd�Zd�Zed�ZRS(s
    This class can be passed a locale name in the constructor and will return
    month and weekday names in the specified locale. If this locale includes
    an encoding all strings containing month and weekday names will be returned
    as unicode.
    icCs8tj||�|dkr+tj�}n||_dS(N(R{RR�R�R�R�(RRR�((s /usr/lib64/python2.7/calendar.pyRscCsYt|j��D}t|}|dk	r:|j|�}nd|j||fSWdQXdS(Ns<th class="%s">%s</th>(R�R�RR�R�R�(RR.R�RR((s /usr/lib64/python2.7/calendar.pyRZ%s

cCset|j��P}t|}|dk	r:|j|�}n|rSd||f}nd|SWdQXdS(Ns%s %ss.<tr><th colspan="7" class="month">%s</th></tr>(R�R�RR�R�(RR\R]R^R�RR((s /usr/lib64/python2.7/calendar.pyR_,s
N(RRRKR�RRZR9R_(((s /usr/lib64/python2.7/calendar.pyR�s	cCscy|jWntk
r*t|��nXt|koBtknsVt|��n|t_dS(N(t	__index__tAttributeErrorRtMONDAYtSUNDAYRpR(R((s /usr/lib64/python2.7/calendar.pyR;s
iicCst|||�GHdS(s1Prints multi-column formatting for year calendarsN(Ro(tcolsRhtspacing((s /usr/lib64/python2.7/calendar.pyRSscs'|d9}|j�fd�|D��S(sEReturns a string formatted from n strings, centered within n columns.RTc3s|]}|j��VqdS(N(RQ(RURp(Rh(s /usr/lib64/python2.7/calendar.pys	<genexpr>[s(RX(R�RhR�((Rhs /usr/lib64/python2.7/calendar.pyRoXs
i�cCsq|d \}}}}}}tj||d�j�t|d}|d|}|d|}	|	d|}
|
S(sBUnrelated but handy function to calculate Unix timestamp from GMT.iiii<(R%R&t	toordinalt
_EPOCH_ORD(ttupleR+R
R.thourtminutetsecondR7thourstminutestseconds((s /usr/lib64/python2.7/calendar.pyR
bs'c	Cs�ddl}|jdd�}|jdddddd	d
ddd
�|jdddddd	d
ddd�|jdddddd	d
ddd�|jdddddd	d
ddd�|jddddd
d dd!�|jd"d#dd$d
ddd%�|jd&d'dd(d
ddd)�|jd*d+ddd
d,d-d6dd/�|j|�\}}|jr�|jr�|jd0�tj	d�n|j|jf}|j
d.kr�|jr�td$|�}n	t�}|j}|dkr�tj
�}ntd(|d|j�}t|�dkrD|jtjj�j|�GHq�t|�dkrt|jt|d�|�GHq�|jd1�tj	d�nM|jr�td$|�}n	t�}td2|jd3|j�}t|�dkr�|j|d4<|j|d5<nt|�dkr2|jtjj�j|�}n�t|�dkrc|jt|d�|�}nXt|�dkr�|jt|d�t|d�|�}n|jd1�tj	d�|jr�|j|j�}n|GHdS(7Ni����tusages%usage: %prog [options] [year [month]]s-ws--widthtdestRFttypetinttdefaultithelps+width of date column (default 2, text only)s-ls--linestlinesis4number of lines for each week (default 1, text only)s-ss	--spacingR�is-spacing between months (default 6, text only)s-ms--monthsRGis%months per row (default 3, text only)s-cs--cssR�scalendar.csssCSS to use for page (html only)s-Ls--localeR�s.locale to be used from month and weekday namess-es
--encodingR�sEncoding to use for outputs-ts--typettexttchoicesthtmlsoutput type (text or html)s/if --locale is specified --encoding is requiredsincorrect number of argumentsRaRbRpRq(stextR�( toptparsetOptionParsert
add_optionR�t
parse_argsR�R�terrorR�texitR�R�R{R�tdictR�R@R�R%R&ttodayR+R�R�RMRFR�R�RGRyR`R�(	R�R�tparsertoptionsR�RjR�toptdicttresult((s /usr/lib64/python2.7/calendar.pytmainls�								
			 
		
!,

	t__main__(((ii(DRKR�R%R�R�t__all__t
ValueErrorR�RRRER0R/RR)RRRRR$R�tTUESDAYt	WEDNESDAYtTHURSDAYtFRIDAYtSATURDAYR�RRRRtobjectR3RMR{R�R�R�RpR5RRRDRRPRNReR[t
weekheaderR	R`R
RyRRzRt	_colwidtht_spacingRRotEPOCHR&R�R�R
R�Rtargv(((s /usr/lib64/python2.7/calendar.pyt<module>sf	-!				
�up
#													
	\

Anon7 - 2022
AnonSec Team