#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /lib/python2.7/site-packages/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /lib/python2.7/site-packages/decorator.pyo
�
��Pc@sVdZdZdddgZddlZddlZddlZejdkrjddlmZd	�Znd
e	fd��YZd�Zej
d
�Zde	fd��YZdd�Zd�Zy2ddlmZedefede��ZWnNek
rEddlmZd�Zedefedede��ZnXee�ZdS(sT
Decorator module, see http://pypi.python.org/pypi/decorator
for the documentation.
s3.4.0t	decoratort
FunctionMakertcontextmanageri����Nt3(tgetfullargspeccCs|jS(N(t__init__(tcls((s-/usr/lib/python2.7/site-packages/decorator.pytget_init*sRcBs eZdZd�Zd�ZRS(s?A quick and dirty replacement for getfullargspec for Python 2.XcCs=tj|�\|_|_|_|_g|_d|_dS(N(	tinspectt
getargspectargstvarargstvarkwtdefaultst
kwonlyargstNonetkwonlydefaults(tselftf((s-/usr/lib/python2.7/site-packages/decorator.pyR/s'	ccs$|jV|jV|jV|jVdS(N(R
RRR
(R((s-/usr/lib/python2.7/site-packages/decorator.pyt__iter__4s(t__name__t
__module__t__doc__RR(((s-/usr/lib/python2.7/site-packages/decorator.pyR-s	cCs
|jjS(N(Rtim_func(R((s-/usr/lib/python2.7/site-packages/decorator.pyR9ss\s*def\s*([_\w][_\w\d]*)\s*\(cBs_eZdZdddddddd�Zd�Zded�Zeddde	d��Z
RS(s�
    An object with the ability to create functions with a given signature.
    It has attributes name, doc, module, signature, defaults, dict and
    methods update and make.
    cCs�||_|r.|j|_|jdkr6d|_n|j|_|j|_tj|�r.t	|�}t
|di�|_x'dD]}	t||	t
||	��q�Wx1t
|j�D] \}
}t|d
|
|�q�Wtjdkrtjdd
�|�dd!|_|_n�t|j�}t|j�}
|jri|jd|j�|
jd|j�n|jr�|jd�nx9|jD].}	|jd|	�|
jd|	|	f�q�W|jr�|jd|j�|
jd|j�ndj|�|_dj|
�|_|jj�|_q.n|r@||_n|dk	rX||_n|rj||_n|r|||_n|r�||_n|r�||_nt|d�s�td|��ndS(Ns<lambda>t_lambda_t__annotations__R
RRR
RRsarg%dRtformatvaluecSsdS(Nt((tval((s-/usr/lib/python2.7/site-packages/decorator.pyt<lambda>Zsii����t*s%s=Nones%s=%ss**s, t	signatures%You are decorating a non function: %s(sargssvarargssvarkwsdefaultss
kwonlyargsskwonlydefaults( tshortsignatureRtnameRtdocRtmoduleRt
isfunctionRtgetattrtannotationstsetattrt	enumerateR
tsystversiont
formatargspecRtlistRtappendRRtjoint__dict__tcopytdictRR
thasattrt	TypeError(RtfuncR!RR
R"R#tfuncdicttargspectatitargtallargstallshortargs((s-/usr/lib/python2.7/site-packages/decorator.pyREs`	
	#			cKs�|j|_t|dd
�|_t|di�|_t|dd�|_t|dd
�|_t|dd
�|_t	j
d�jjdd�}t|d	|�|_
|jj|�d
S(s2Update the signature of func with the data in selfR"R1R
RR&iRt?R#N((R!RR%RRR/t
func_defaultst__kwdefaults__RR)t	_getframet	f_globalstgetRtupdate(RR4tkwtcallermodule((s-/usr/lib/python2.7/site-packages/decorator.pyRB~sc
Js\|e|�}|pi}ej|�}|d
krJed|��n|jd�}e|gg|jjd�D]}|j	d�^qu�}	x3|	D]+}
|
dkr�e
d|
|f��q�q�W|jd�s�|d7}nye|d	d
�}||UWn$e
jdIJe
j|IJ�nX||}|rH||d<n|j||�|S(sBMake a new function from a given template and update the signatures not a valid function template
%sit,s *t_func_t_call_s%s is overridden in
%ss
s<string>tsinglesError in generated code:t
__source__N(s_func_RG(tvarstDEFtmatchRtSyntaxErrortgrouptsetR tsplittstript	NameErrortendswithtcompileR)tstderrRB(
Rt	src_templtevaldictt	addsourcetattrstsrctmoR!R9tnamestntcodeR4((s-/usr/lib/python2.7/site-packages/decorator.pytmake�s2/





cKs�t|t�r@|j�jdd�\}	}
|
d }d}nd}	d}|}|||	||||�}
djd�|j�D��}|
jd||||�S(s�
        Create a function from the strings name, signature and body.
        evaldict is the evaluation dictionary. If addsource is true an attribute
        __source__ is added to the result. The attributes attrs are added,
        if any.
        t(ii����s
css|]}d|VqdS(s    N((t.0tline((s-/usr/lib/python2.7/site-packages/decorator.pys	<genexpr>�ssdef %(name)s(%(signature)s):
N(t
isinstancetstrRQRPRR.t
splitlinesR_(RtobjtbodyRWR
R"R#RXRYR!trestRR4Rtibody((s-/usr/lib/python2.7/site-packages/decorator.pytcreate�s	
	
N(RRRRRRBtFalseR_tclassmethodtTrueRj(((s-/usr/lib/python2.7/site-packages/decorator.pyR?s	8	cCs�|dk	rN|jj�}||d<||d<tj|d|d|d|�Stj|�r�|jj�}t	|�}d|j|jf}t
|�jd}n�tj|�r�|jdkr�d	n|j}|}|j
}t
|�jd
}n=|jjj�}|jj}|jj
}t
|�jd}|jj�}||d<t|d<tjd||fd
||d|d|d|d|j�SdS(s�
    decorator(caller) converts a caller function into a decorator;
    decorator(caller, func) decorates a function using a caller.
    RGRFs)return _call_(_func_, %(shortsignature)s)tundecoratedt__wrapped__sHdecorator(%s) converts functions/generators into factories of %s objectsis<lambda>RiRs%s(%s)sreturn decorator(_call_, %s)R"R#N(Rtfunc_globalsR0RRjRtisclassRtlowerRRR
R$Rt	__class__t__call__RRR(tcallerR4RWR!t
callerfuncR"tfun((s-/usr/lib/python2.7/site-packages/decorator.pyR�s>

		


cCs(tj|dtd|d|�d|�S(sContext manager decorators.with _self_: return _func_(%(shortsignature)s)t_self_RFRo(RRjR1(RR4((s-/usr/lib/python2.7/site-packages/decorator.pyRt�s(t_GeneratorContextManagertContextManagerRt(tGeneratorContextManagercOstj||||��S(N(R{R(RRR7tk((s-/usr/lib/python2.7/site-packages/decorator.pyR�sR(Rt__version__t__all__R)treRR*RRtobjectRTRKRRRRtt
contextlibRyttypeR1RztImportErrorR{RR(((s-/usr/lib/python2.7/site-packages/decorator.pyt<module>!s.$	~)	
		

Anon7 - 2022
AnonSec Team